VIP (Vasoactive Intestinal Peptide) Antibody

VIP (Vasoactive Intestinal Peptide) Antibody
Click to enlarge
Price: $300.00
Product ID : 20077



The antibody has a proven strong Biotin-Streptavidin/HRP staining at a 1/4000-1/6000 dilution in rat amygdala, cortex, and suprachiasmatic nucleus.

The specificity of the antiserum was examined by soluble pre-adsorption with the peptides in question at a final concentration of 10-5 M. VIP immunolabeling was completely abolished by pre-adsorption with VIP. Pre-adsorption with the following peptides resulted in no reduction of immunostaining: Secretin, gastric inhibitory polypeptide, somatostatin, glucagon, insulin, ACTH, gastrin 34, FMRF-amide, rat GHRF, human GHRF, peptide histidine isoleucine 27, rat pancreatic polypeptide, motilin, peptide YY, substance P, neuropeptide Y, and CGRP.

The histochemical antibody for VIP is generated in a rabbit against porcine VIP conjugated to bovine thyroglobulin with carbodiimide. The antibody is provided as 100 µL of lyophilized whole serum, and 0.09% sodium azide.

Photo Description: IHC image of rat cortex (above) and low magnification image of rat striatum and amygdala staining for VIP (below). The tissue was fixed with 4% formaldehyde in phosphate buffer, before being removed and prepared for vibratome sectioning. Floating sections were incubated at RT in 10% goat serum in PBS, before standard IHC procedure. Primary antibody was incubated at 1:5000 for 48 hours, goat anti-rabbit secondary was subsequently added for 1 hour after washing with PBS. Light microscopy staining was achieved with standard biotin-streptavidin/HRP procedure and DAB chromogen.

VIP Amygdala striatum #20077


Quantity / Volume: 100 µL

State: Lyophilized Whole Serum

Reacts With: Avian (Bird), Bat, Bubalus Bubalis (Buffalo), Bullfrog, Canine, Cat, Chick, Chicken, Dog, Dove, Fish, Fowl, Fox, Frog, Gilt (Pig), Goldfish, Guinea Pig, Hamster, Hedgehog, Hen, Human, Lizard, Mink, Mole, Mollusk, Monkey, Mouse, Mudpuppy (Necturus Maculosus), Ovine, Pig, Pigeon, Platypus, Possum, Rabbit, Raccoon, Ram, Rat, Scorpaena Porcus (Fish), Sea Lamprey, Sheep, Shrew, Snake, Sparrow, Sparus Aurata (Fish), Squirrel, Starfish, Sting Ray, Suncus Murinus, Tadpole, Turkey, Turtle, Worm (Spionidae), Zebra Finch, Zebrafish

Availability: In Stock

Preabsorption Control: Available at Sigma Aldrich, Catalog # V6130

Alternate Names:  Vasoactive intestinal polypeptide; VIP peptides, anti-VIP

Gene Symbol / ID, Accession #:  VIP,7432

RRID:  AB_572270


Login or Register to write a review.
Reviewed by ld2596
03/19/2015 - 01:48:03 PM
Works Great!

We have used this antibody to stain for VIP positive neurons (also stains processes) in frozen tissue sections and whole mount preparations of mouse intestine. We get consistent staining at 1:750.

Tissue prep:
4% PFA/PBS for 1.5 hrs, cryoprotected in 30% sucrose until they sink, OCT embedded, and sectioned.
For whole mounts, we open up intestine and fix in 4% PFA/PBS for 1.5 hrs.

IF protocol:
Rehydrate in PBS, block with HINGS, stain in primary @4C O/N.
Wash in PBST, stain in primary with HINGS and DMSO @4C 48 hrs.

Wash with PBS, stain with Alexafluor secondaries (Invitrogen), wash with PBS, and DAPI mount.
Wash in PBST, stain in secondary with HINGS and DMSO @RT 48 hrs.
Optional: proceed with MeOH dehydration and optical clearing.

Meenakshi Rao, MD PhD
Assistant Professor of Pediatrics
Columbia University Medical Center
New York, NY 10032

Reviewed by user
08/22/2012 - 02:45:39 PM
Worked like a charm

After failed several experiments by using other antibodies, we applied VIP antibody (20077) for mouse brain tissue sections for suprachiasmatic nucleus immunohistochemistry.

It turned out that this antibody worked like a charm on my frozen sections. This is definitely an excellent VIP antibody.

Dr. David Ma, Research scientist
Chandler, AZ


20077 VIP (Vasoactive Intestinal Peptide) Antibody Moga, Margaret M. "192 IgG-saporin abolishes p75 neurotrophin receptor immunoreactivity in rat SCN." NeuroReport 9.14 (1998): 3197-3200. Rat 9 9831450
20077 VIP (Vasoactive Intestinal Peptide) Antibody Schramm, Christoph, et al. "675 Autoimmune hepatitis and pregnancy: Course of disease and outcome of pregnancies." Hepatology 38 (2003): 486. 1 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Buchan, A. M. J., et al. "A comparison of the ability of serum and monoclonal antibodies to gastric inhibitory polypeptide to detect immunoreactive cells in the gastroenteropancreatic system of mammals and reptiles." Histochemistry 76.3 (1982): 341-349. 40 6186646
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jolkkonen, J., et al. "A correlation study of CSF neuropeptides in Alzheimer's and Parkinson's disease." Neuropeptides 19.2 (1991): 97-102. IHC parkinson, alzheimer 14 1682848
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lee, Soohyun, et al. "A disinhibitory circuit mediates motor integration in the somatosensory cortex." Nature neuroscience 16.11 (2013): 1662-1670. 19 24097044
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Comp Neurol. 1983 Dec 10;221(3):247-62. A morphological analysis of vasoactive intestinal polypeptide (VIP)-like immunoreactive neurons in the area dentata of the rat brain. Köhler C. Rat 43 6197428
20077 VIP (Vasoactive Intestinal Peptide) Antibody Blatow, Maria, et al. "A novel network of multipolar bursting interneurons generates theta frequency oscillations in neocortex." Neuron 38.5 (2003): 805-817. Guinea Pig IHC 206 12797964
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ma, Tong, et al. "A subpopulation of dorsal lateral/caudal ganglionic eminence-derived neocortical interneurons expresses the transcription factor Sp8." Cerebral Cortex 22.9 (2012): 2120-2130. Mouse IHC Transcription Factor 12 22021915
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kapur, R. P., C. Y. N. T. H. I. A. Yost, and RICHARD D. Palmiter. "A transgenic model for studying development of the enteric nervous system in normal and aganglionic mice." Development 116.1 (1992): 167-175. Mouse IHC 162 1483385
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gelman, Diego, et al. "A wide diversity of cortical GABAergic interneurons derives from the embryonic preoptic area." The Journal of Neuroscience 31.46 (2011): 16570-16580. Mouse IHC 25 22090484
20077 VIP (Vasoactive Intestinal Peptide) Antibody Clark, Daniel D., et al. "Aberrant development of the suprachiasmatic nucleus and circadian rhythms in mice lacking the homeodomain protein Six6." Journal of biological rhythms 28.1 (2013): 15-25. Mouse 1 23382588
20077 VIP (Vasoactive Intestinal Peptide) Antibody Bowsher, David, et al. "Absence of pain with hyperhidrosis: a new syndrome where vascular afferents may mediate cutaneous sensation." Pain 147.1 (2009): 287-298. IHC 16 19836135
20077 VIP (Vasoactive Intestinal Peptide) Antibody Perrenoud, Quentin, et al. "Activation of cortical 5-HT3 receptor-expressing interneurons induces NO mediated vasodilatations and NPY mediated vasoconstrictions." Frontiers in neural circuits 6 (2012). Mouse IF 7 22907992
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lee, Seung-Hee, et al. "Activation of specific interneurons improves V1 feature selectivity and visual perception." Nature 488.7411 (2012): 379-383. Mouse IHC 78 22878719
20077 VIP (Vasoactive Intestinal Peptide) Antibody Barja, F., and R. Mathison. "Adrenergic and peptidergic (substance P and vasoactive intestinal polypeptide) innervation of the rat portal vein." Journal of Vascular Research 19.5 (1982): 263-272. 54 6180787
20077 VIP (Vasoactive Intestinal Peptide) Antibody Qualman, Stephen J., and Robert Murray. "Aganglionosis and related disorders." Human pathology 25.11 (1994): 1141-1149. 42 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cha, Choong Ik, et al. "Age related change in the vasoactive intestinal polypeptide-immunoreactive neurons in the cerebral cortex of aged rats." Neuroscience letters 197.1 (1995): 45-48. Rat 6 8545052
20077 VIP (Vasoactive Intestinal Peptide) Antibody Exp Eye Res. 2005 Apr;80(4):477-91. Age-dependent alterations in mouse exorbital lacrimal gland structure, innervation and secretory response. Ríos JD1, Horikawa Y, Chen LL, Kublin CL, Hodges RR, Dartt DA, Zoukhri D. Mouse 42 15781275
20077 VIP (Vasoactive Intestinal Peptide) Antibody Invest Ophthalmol Vis Sci. 2011 Jan 21;52(1):364-73. doi: 10.1167/iovs.10-5347. Print 2011 Jan. Cone degeneration following rod ablation in a reversible model of retinal degeneration. Choi RY1, Engbretson GA, Solessio EC, Jones GA, Coughlin A, Aleksic I, Zuber ME. Human IHC 17251439
20077 VIP (Vasoactive Intestinal Peptide) Antibody Teitelbaum, Daniel H., et al. "Alteration in gastrointestinal peptide tissue levels in rejecting small bowel transplants." Journal of pediatric surgery 24.7 (1989): 629-633. Rat IHC 17 2474067
20077 VIP (Vasoactive Intestinal Peptide) Antibody Mauro, L. J., et al. "Alterations in Hypothalamic Vasoactive Intestinal Peptide-Like Immunoreactivity Are Associated with Reproduction and Prolactin Release in the Female Turkey*." Endocrinology 125.4 (1989): 1795-1804. Turkey IHC 87 2676472
20077 VIP (Vasoactive Intestinal Peptide) Antibody Smith, Michael A., et al. "Altered TSH levels associated with increased serum 1, 25= dihydroxyvitamin D3: A possible link between thyroid and parathyroid disease." rig 1050.400 (1989): 350. IHC parathyroid 16 2511635
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rozov, Andrei, et al. "AMPA receptor channels with long-lasting desensitization in bipolar interneurons contribute to synaptic depression in a novel feedback circuit in layer 2/3 of rat neocortex." The Journal of Neuroscience 21.20 (2001): 8062-8071. Rat IF 88 11588179
20077 VIP (Vasoactive Intestinal Peptide) Antibody Eckenstein, F. P., R. W. Baughman, and J. Quinn. "An anatomical study of cholinergic innervation in rat cerebral cortex." Neuroscience 25.2 (1988): 457-474. Rat 245 2456488
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cutz, E., L. Goniakowska-Witalinska, and W. Chan. "An immimohistochemical study of regulatory peptides in lungs of amphibians." Cell and tissue research 244.1 (1986): 227-233. IHC 41 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hino, N., S. Masuko, and Takeshi Katsuki. "An immunohistochemical study of sensory and autonomic innervation of the dog tongue with special reference to substance P-and calcitonin gene-related peptide-containing fibers in blood vessels and the intralingual ganglia." Archives of histology and cytology 56 (1993): 505-505. Dog 15 7510508
20077 VIP (Vasoactive Intestinal Peptide) Antibody Heller, Stefan, et al. "Analysis of function and expression of the chick GPA receptor (GPAR alpha) suggests multiple roles in neuronal development." Development 121.8 (1995): 2681-2693. Chick 47 7671828
20077 VIP (Vasoactive Intestinal Peptide) Antibody Birch, D., et al. "Analysis of innervation of human mesenteric vessels in non?inflamed and inflamed bowel Human 20 18298440
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Neuroimmunol. 2007 Apr;185(1-2):64-74. Epub 2007 Mar 23. Anatomical evidence for enteric neuroimmune interactions in Peyer's patches. Vulchanova L1, Casey MA, Crabb GW, Kennedy WR, Brown DR. Pig IHC 17363074
20077 VIP (Vasoactive Intestinal Peptide) Antibody Donadio, Vincenzo, et al. "Anhidrosis in multiple system atrophy: a preganglionic sudomotor dysfunction?." Movement Disorders 23.6 (2008): 885-888. Human 11 18361470
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gosney, John, A. R. Green, and W. Taylor. "Appropriate and inappropriate neuroendocrine products in pulmonary tumourlets." Thorax 45.9 (1990): 679-683. Human 6 2145655
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hilz, Max J., et al. "Assessing function and pathology in familial dysautonomia: assessment of temperature perception, sweating and cutaneous innervation." Brain 127.9 (2004): 2090-2098. Human IF 34 15240436
20077 VIP (Vasoactive Intestinal Peptide) Antibody LeSauter, J., et al. "Attachment site of grafted SCN influences precision of restored circadian rhythm." Journal of biological rhythms 12.4 (1997): 327-338. ICC 15 9438881
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hiebert, Jean, and Peter G. Smith. "Autonomic and sensory reinnervation of smooth muscle transplanted to the anterior chamber of the eye: effect of target postnatal age." Experimental neurology 127.1 (1994): 137-144. 5 8200431
20077 VIP (Vasoactive Intestinal Peptide) Antibody Donadio, Vincenzo, et al. "Autonomic innervation in multiple system atrophy and pure autonomic failure." Journal of Neurology, Neurosurgery & Psychiatry 81.12 (2010): 1327-1335. 13 20660924
20077 VIP (Vasoactive Intestinal Peptide) Antibody Karube, Fuyuki, Yoshiyuki Kubota, and Yasuo Kawaguchi. "Axon branching and synaptic bouton phenotypes in GABAergic nonpyramidal cell subtypes." The Journal of neuroscience 24.12 (2004): 2853-2865. Rat IHC 99 15044524
20077 VIP (Vasoactive Intestinal Peptide) Antibody SALTZMAN, JOHN R., et al. "Bacterial Overgrowth Without Clinical Hypochlorhydric Subjects." Gastroenterology 106.3 (1994): 615-623. 135 8119531
20077 VIP (Vasoactive Intestinal Peptide) Antibody Mol Cell Neurosci. 2006 Dec;33(4):381-8. Epub 2006 Oct 9. BDNF up-regulates alpha7 nicotinic acetylcholine receptor levels on subpopulations of hippocampal interneurons. Massey KA1, Zago WM, Berg DK. Rat IF 17029981
20077 VIP (Vasoactive Intestinal Peptide) Antibody Pecins-Thompson, M., A. A. Widmann, and C. L. Bethea. "Beta-endorphin, but not oxytocin, substance P or vasoactive-intestinal polypeptide, contributes to progesterone-induced prolactin secretion in monkeys." Neuroendocrinology 63.6 (1996): 569-578. Monkey 9 8793899
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hill, Joanna M., et al. "Blockage of VIP during mouse embryogenesis modifies adult behavior and results in permanent changes in brain chemistry." Journal of molecular neuroscience 31.3 (2007): 183-200. Mouse ICC 16 17726225
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cellerino A1, Arango-González B, Pinzón-Duarte G, Kohler K, J Comp Neurol. 2003 Dec 1;467(1):97-104. Brain-derived neurotrophic factor regulates expression of vasoactive intestinal polypeptide in retinal amacrine cells Rat IHC 19 14574682
20077 VIP (Vasoactive Intestinal Peptide) Antibody Neuron. 2010 Sep 9;67(5):858-71. doi: 10.1016/j.neuron.2010.08.002.Broadly tuned response properties of diverse inhibitory neuron subtypes in mouse visual cortex. Kerlin AM1, Andermann ML, Berezovskii VK, Reid RC. Mouse IF 20826316
20077 VIP (Vasoactive Intestinal Peptide) Antibody Silver, Rae, et al. "Calbindin-D28K cells in the hamster SCN express light-induced Fos." Neuroreport 7.6 (1996): 1224. Hamster 112 8817537
20077 VIP (Vasoactive Intestinal Peptide) Antibody Bove, Geoffrey M., and Alan R. Light. "Calcitonin gene-related peptide and peripherin immunoreactivity in nerve sheaths." Somatosensory & motor research 12.1 (1995): 49-57. 27 7571942
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, Tatsumi, Tadashi Kawakami, and Toshifumi Takenaka. "Calcitonin gene-related peptide and substance P in the pharynx and lung of the bullfrog, Rana catesbeiana." Cell and tissue research 279.1 (1995): 115-121. Bullfrog 10 7534647
20077 VIP (Vasoactive Intestinal Peptide) Antibody Saito, A. K. I. R. A., et al. "Calcitonin gene-related peptide and vasodilator nerves in large cerebral arteries of cats." Journal of Pharmacology and Experimental Therapeutics 248.1 (1989): 455-462. Cat 85 2783612
20077 VIP (Vasoactive Intestinal Peptide) Antibody Alston, Eric N., et al. "Cardiac ischemia-reperfusion regulates sympathetic neuropeptide expression through gp130-dependent and independent mechanisms." Neuropeptides 45.1 (2011): 33-42. Mouse IHC 13 21035185
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keast, Janet R. "Catecholamine innervation of the intestine of flying foxes (Pteropus spp.): a substantial supply from enteric neurons." Cell and tissue research 276.2 (1994): 403-410. Fox 2 7912656
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kulkarni-Narla A1, Beitz AJ, Brown DR, Cell Tissue Res. 1999 Nov;298(2):275-86. "Catecholaminergic, cholinergic and peptidergic innervation of gut-associated lymphoid tissue in porcine jejunum and ileum" Pig IF 10571116
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hioki, Hiroyuki, et al. "Cell Type-Specific Inhibitory Inputs to Dendritic and Somatic Compartments of Parvalbumin-Expressing Neocortical Interneuron." The Journal of Neuroscience 33.2 (2013): 544-555. Mouse IF 5 23303934
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jinno, Shozo, and Toshio Kosaka. "Cellular architecture of the mouse hippocampus: a quantitative aspect of chemically defined GABAergic neurons with stereology." Neuroscience research 56.3 (2006): 229-245. Mouse 55 16930755
20077 VIP (Vasoactive Intestinal Peptide) Antibody Grover, Madhusudan, et al. "Cellular changes in diabetic and idiopathic gastroparesis." Gastroenterology 140.5 (2011): 1575-1585. Human IF 74 21300066
20077 VIP (Vasoactive Intestinal Peptide) Antibody Montgomery, Jenna R., et al. "Cellular Circadian Rhythms: Mis-expression of the BK K+ channel disrupts suprachiasmatic nucleus circuit rhythmicity and alters clock-controlled behavior." American Journal of Physiology-Cell Physiology 304.4 (2013): C299. Mouse IHC 0 23174562
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hattar, Samer, et al. "Central projections of melanopsin?expressing retinal ganglion cells in the mouse." Journal of Comparative Neurology 497.3 (2006): 326-349. Mouse IHC 294 16736474
20077 VIP (Vasoactive Intestinal Peptide) Antibody Scand J Gastroenterol. 2001 Feb;36(2):180-9. Changes in distribution of three isoforms of nitric oxide synthase in ulcerative colitis. Vento P1, Kiviluoto T, Järvinen HJ, Soinila S. ulcerative colitis 21 11252411
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vilches, Jorge J., et al. "Changes in mouse sudomotor function and sweat gland innervation with ageing." Autonomic Neuroscience 95.1 (2002): 80-87. 17 11871787
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, T., et al. "Changes in the peptidergic innervation in the carotid body of rats chronically exposed to hypercapnic hypoxia: an effect of arterial CO2 tension." (2002). Rat IHC Hypoxia 10 11813872
20077 VIP (Vasoactive Intestinal Peptide) Antibody Chamary, V. L., et al. "Changes in vasoconstrictor and vasodilator neurotransmitters in nerves supplying arterioles in developing colorectal polyps." Colorectal Disease 8.3 (2006): 230-234. Human IHC 5 16466565
20077 VIP (Vasoactive Intestinal Peptide) Antibody Uemura, Yoshihiko, et al. "Changes of vasoactive intestinal polypeptide-like immunoreactivity in cerebrovascular nerve fibers after cervical sympathectomy in the dog." Neuroscience letters 82.1 (1987): 6-10. Dog 4 3696485
20077 VIP (Vasoactive Intestinal Peptide) Antibody Uemura, Yoshihiko, et al. "Changes of vasoactive intestinal polypeptide-like immunoreactivity in cerebrovascular nerve fibers after subarachnoid hemorrhage: an experimental study in the dog." Neuroscience letters 71.2 (1986): 137-141. Dog 13 3537849
20077 VIP (Vasoactive Intestinal Peptide) Antibody Pohlkamp, Theresa, et al. "Characterization and Distribution of Reelin-Positive Interneuron Subtypes in the Rat Barrel Cortex." Cerebral Cortex (2013): bht161. Rat IHC 0 23803971
20077 VIP (Vasoactive Intestinal Peptide) Antibody Chen, R., et al. "Characterization of immature and mature 5-hydroxytryptamine 3A receptor-expressing cells within the adult SVZ IHC 4 23041763
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sousa, Vitor H., et al. "Characterization of Nkx6-2-derived neocortical interneuron lineages." Cerebral cortex 19.suppl 1 (2009): i1-i10. Mouse IHC 88 19363146
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ward, S. A., et al. "Characterization of ramified microglia in tissue culture: pinocytosis and motility." Journal of neuroscience research 29.1 (1991): 13-28. 53 1886165
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hill, David P., and Kent A. Robertson. "Characterization of the cholinergic neuronal differentiation of the human neuroblastoma cell line LA-N-5 after treatment with retinoic acid." Developmental brain research 102.1 (1997): 53-67. Human IHC 35 9298234
20077 VIP (Vasoactive Intestinal Peptide) Antibody Galli, G., et al. "Characterization of the functional and growth properties of long-term cell cultures established from a human somatostatinoma." Endocrine-related cancer 13.1 (2006): 79-93. Human 4 16601281
20077 VIP (Vasoactive Intestinal Peptide) Antibody Meedeniya, Adrian Cuda Banda, et al. "Characterization of the intrinsic and extrinsic innervation of the gall bladder epithelium in the Australian Brush?tailed possum (Trichosurus vulpecula)." Neurogastroenterology & Motility 15.4 (2003): 383-392. Possum 14 12846726
20077 VIP (Vasoactive Intestinal Peptide) Antibody Wray, S., M. Castel, and H. Gainer. "Characterization of the suprachiasmatic nucleus in organotypic slice explant cultures." Microscopy research and technique 25.1 (1993): 46-60. 29 8353307
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rockland, Kathleen S. "Characterization of type I and type II nNOS-expressing interneurons in the barrel cortex of mouse." Cortical NO interneurons from embryogenesis to functions (2014): 24. Mouse IHC 0 22754499
20077 VIP (Vasoactive Intestinal Peptide) Antibody Poonyachoti, Sutthasinee, Anjali Kulkarni-Narla, and David R. Brown. "Chemical coding of neurons expressing ?-and ?-opioid receptor and type I vanilloid receptor immunoreactivities in the porcine ileum." Cell and tissue research 307.1 (2002): 23-33. 52 11810311
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cantwell, Elizabeth L., and Vincent M. Cassone. "Chicken suprachiasmatic nuclei: II. Autoradiographic and immunohistochemical analysis." Journal of Comparative Neurology 499.3 (2006): 442-457. Chicken IHC 12 16998905
20077 VIP (Vasoactive Intestinal Peptide) Antibody Synapse. 2006 Sep 15;60(4):295-306. Choline acetyl transferase and neuropeptide immunoreactivities are colocalized in somata, but preferentially localized in distinct axon fibers and boutons of cat sympathetic preganglionic neurons.Sámano C1, Zetina ME, Marín MA, Cifuentes F, Morales MA. Cat IHC 9 16786529
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rohrer, H. "Cholinergic neuronal differentiation factors: evidence for the presence of both CNTF-like and non-CNTF-like factors in developing rat footpad." Development 114.3 (1992): 689-698. Rat IHC 49 1618136
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hakim, Harvey, Angela Philpot DeBernardo, and Rae Silver. "Circadian locomotor rhythms, but not photoperiodic responses, survive surgical isolation of the SCN in hamsters." Journal of biological rhythms 6.2 (1991): 97-113. Hamster 54 1773090
20077 VIP (Vasoactive Intestinal Peptide) Antibody DeCoursey, Patricia J., and James Buggy. "Circadian rhythmicity after neural transplant to hamster third ventricle: specificity of suprachiasmatic nuclei." Brain research 500.1 (1989): 263-275. Hamster IHC 90 2605495
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lehman, M. N., et al. "Circadian rhythmicity restored by neural transplant. Immunocytochemical characterization of the graft and its integration with the host brain." The Journal of neuroscience 7.6 (1987): 1626-1638. Hamster 384 3598638
20077 VIP (Vasoactive Intestinal Peptide) Antibody McDonald, Alexander J., and John C. Pearson. "Coexistence of GABA and peptide immunoreactivity in non-pyramidal neurons of the basolateral amygdala." Neuroscience letters 100.1 (1989): 53-58. 178 2569703
20077 VIP (Vasoactive Intestinal Peptide) Antibody Chiba, Tanemichi, and Sadahiko Masuko. "Coexistence of multiple peptides in small intensely fluorescent (SIF) cells of inferior mesenteric ganglion of the guinea pig." Cell and tissue research 255.3 (1989): 523-527. Guinea Pig 14 2565164
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, Tatsumi, Tadashi Kawakami, and Toshifumi Takenaka. "Coexistence of substance P, neuropeptide Y, VIP, and CGRP in the nerve fibers of the carotid labyrinth of the bullfrog, Rana catesbeiana: a double-labelling immunofluorescence study in combination with alternate consecutive sections." Cell and tissue research 276.1 (1994): 91-97. Bullfrog 22 7514501
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ogawa, Reiko, et al. "Co-existence of vasoactive intestinal polypeptide (VIP)-and cholecystokinin (CCK)-like immunoreactivities in thalamocortical neuron in the ventrolateral nucleus of the rat." Brain research 490.1 (1989): 152-156. Rat 15 2758323
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tsumori, T., et al. "Coexistence of vasoactive intestinal polypeptide and neuropeptide Y immunoreactivity within axon terminals in the canine and human lower esophageal sphincter: electron microscopy by a double immunogold labeling procedure." Cells Tissues Organs 149.4 (1994): 272-278. Human, Canine 5 7976180
20077 VIP (Vasoactive Intestinal Peptide) Antibody Houdeau, Eric, et al. "Coexpression of neuropeptide Y and vasoactive intestinal polypeptide in pelvic plexus neurones innervating the uterus and cervix in the rat." Cell and tissue research 288.2 (1997): 285-292. Rat 18 9082964
20077 VIP (Vasoactive Intestinal Peptide) Antibody Silver, Rae, et al. "Coexpression of opsin-and VIP-like-immunoreactivity in CSF-contacting neurons of the avian brain." Cell and tissue research 253.1 (1988): 189-198. Avian (Bird) 159 2970894
20077 VIP (Vasoactive Intestinal Peptide) Antibody Shen, T., et al. "Co-expression patterns of the neuropeptides vasoactive intestinal peptide and cholecystokinin with the transduction molecules ?-gustducin and T1R2 in rat taste receptor cells." Neuroscience 130.1 (2005): 229-238. Rat ICC 59 15561439
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jen, Phillip YP, John S. Dixon, and John A. Gosling. "Co-localisation of tyrosine hydroxylase, nitric oxide synthase and neuropeptides in neurons of the human postnatal male pelvic ganglia." Journal of the autonomic nervous system 59.1 (1996): 41-50. Human 27 8816364
20077 VIP (Vasoactive Intestinal Peptide) Antibody Yoshida, Kazuhide, and Noboru Toda. "Colocalization of acetylcholinesterase and vasoactive intestinal peptide (VIP) in nicotinamide adenine dinucleotide phosphate diaphorase (NADPH-d) positive neurons in the intralingual ganglia and perivascular nerve fibers around lingual arteries in the porcine, monkey and canine tongue." Neuroscience letters 222.3 (1997): 147-150. Monkey, Canine 12 9148236
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Auton Nerv Syst. 1995 Sep 5;54(3):177-83. Co-localization of NADPH diaphorase reactivity and vasoactive intestinal polypeptide in human colon. Keränen U1, Vanhatalo S, Kiviluoto T, Kivilaakso E, Soinila S. Human 30 7490419
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hiramatsu, Kohzy, and Koji Ohshima. "Colocalization of NADPH-diaphorase with neuropeptides in the intrapancreatic neurons of the chicken." Neuroscience letters 182.1 (1994): 37-40. Chicken 14 7534388
20077 VIP (Vasoactive Intestinal Peptide) Antibody Afework, Mekbeb, and Geoffrey Burnstock. "Colocalization of neuropeptides and NADPH-diaphorase in the intra-adrenal neuronal cell bodies and fibres of the rat." Cell and tissue research 280.2 (1995): 291-295. Rat 12 7781027
20077 VIP (Vasoactive Intestinal Peptide) Antibody Domoto, Tokio, and Toshiko Tsumori. "Co-localization of nitric oxide synthase and vasoactive intestinal peptide immunoreactivity in neurons of the major pelvic ganglion projecting to the rat rectum and penis." Cell and tissue research 278.2 (1994): 273-278. Rat 31 7528096
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jen, P. Y. P., J. S. Dixon, and J. A. Gosling. "Co?localization of nitric oxide synthase, neuropeptides and tyrosine hydroxylase in nerves supplying the human post?natal vas deferens and seminal vesicle." British journal of urology 80.2 (1997): 291-299. Human 31 9284205
20077 VIP (Vasoactive Intestinal Peptide) Antibody Honkaniemi, J., et al. "Colocalization of peptide and glucocorticoid receptor immunoreactivities in rat central amygdaloid nucleus." Neuroendocrinology 55.4 (1992): 451-459. Rat 86 1373477
20077 VIP (Vasoactive Intestinal Peptide) Antibody De Girolamo, P., et al. "Co?localization of Trk neurotrophin receptors and regulatory peptides in the endocrine cells of the teleostean stomach." The Anatomical Record 256.3 (1999): 219-226. Sparus Aurata (Fish), Scorpaena Porcus (Fish) IHC 26 10521780
20077 VIP (Vasoactive Intestinal Peptide) Antibody Casini, Giovanni, and Nicholas C. Brecha. "Colocalization of vasoactive intestinal polypeptide and GABA immunoreactivities in a population of wide-field amacrine cells in the rabbit retina." Visual neuroscience 8.04 (1992): 373-378. Rabbit 23 1348629
20077 VIP (Vasoactive Intestinal Peptide) Antibody Crone, Steven A., et al. "Colonic epithelial expression of ErbB2 is required for postnatal maintenance of the enteric nervous system." Neuron 37.1 (2003): 29-40. Mouse IHC 53 12526770
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tricoire, Ludovic, et al. "Common origins of hippocampal Ivy and nitric oxide synthase expressing neurogliaform cells." The Journal of Neuroscience 30.6 (2010): 2165-2176. Mouse IF 51 20147544
20077 VIP (Vasoactive Intestinal Peptide) Antibody Selzer, Faith, et al. "Comparison of risk factors for vascular disease in the carotid artery and aorta in women with systemic lupus erythematosus." Arthritis & Rheumatism 50.1 (2004): 151-159. Human 183 14730611
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawatani, Masahito, Takashi Suzuki, and William C. de Groat. "Corticotropin releasing factor-like immunoreactivity in afferent projections to the sacral spinal cord of the cat." Journal of the autonomic nervous system 61.3 (1996): 218-226. Cat 18 8988478
20077 VIP (Vasoactive Intestinal Peptide) Antibody Skofitsch, Gerhard, et al. "Corticotropin releasing factor-like immunoreactivity in sensory ganglia and capsaicin sensitive neurons of the rat central nervous system: colocalization with other neuropeptides." Peptides 6.2 (1985): 307-318. Rat IHC 94 3875838
20077 VIP (Vasoactive Intestinal Peptide) Antibody Berkenbosch, F., J. Schipper, and F. J. H. Tilders. "Corticotropin-releasing factor immunostaining in the rat spinal cord and medulla oblongata: an unexpected form of cross-reactivity with substance P." Brain research 399.1 (1986): 87-96. Rat 25 2433002
20077 VIP (Vasoactive Intestinal Peptide) Antibody Nolano, Maria, et al. "Cutaneous innervation of the human face as assessed by skin biopsy." Journal of anatomy 222.2 (2013): 161-169. Human 6 23078075
20077 VIP (Vasoactive Intestinal Peptide) Antibody Magnone, Maria Chiara, et al. "Daily and circadian rhythms of neurotransmitters and related compounds in the hypothalamic suprachiasmatic nuclei of a diurnal vertebrate." Brain research 973.1 (2003): 115-121. 4 12729960
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hasan, Wohaib, and Peter G. Smith. "Decreased adrenoceptor stimulation in heart failure rats reduces NGF expression by cardiac parasympathetic neurons." Autonomic Neuroscience (2013). Rat 1 24332566
20077 VIP (Vasoactive Intestinal Peptide) Antibody Corns, Robert A., Usha V. Boolaky, and Robert M. Santer. "Decreased calbindin-D28k immunoreactivity in aged rat sympathetic pelvic ganglionic neurons." Neuroscience letters 292.2 (2000): 91-94. Rat 11 10998556
20077 VIP (Vasoactive Intestinal Peptide) Antibody Linnoila, R. Ilona, et al. "Decreased expression of neuropeptides in malignant paragangliomas: an immunohistochemical study." Human pathology 19.1 (1988): 41-50. IHC 71 2447010
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tyan, Leonid, et al. "Dendritic Inhibition Provided by Interneuron-Specific Cells Controls the Firing Rate and Timing of the Hippocampal Feedback Inhibitory Circuitry." The Journal of Neuroscience 34.13 (2014): 4534-4547. 0 24671999
20077 VIP (Vasoactive Intestinal Peptide) Antibody Dail, William G., et al. "Denervation-induced changes in perineuronal plexuses in the major pelvic ganglion of the rat: immunohistochemistry for vasoactive intestinal polypeptide and tyrosine hydroxylase and histochemistry for NADPH-diaphorase." Cell and tissue research 287.2 (1997): 315-324. Rat 18 8995202
20077 VIP (Vasoactive Intestinal Peptide) Antibody Asa, S. L., Y. C. Lee, and D. J. Drucker. "Development of colonic and pancreatic endocrine tumours in mice expressing a glucagon-SV40 T antigen transgene." Virchows Archiv 427.6 (1996): 595-606. Mouse 21 8605571
20077 VIP (Vasoactive Intestinal Peptide) Antibody Anderson, Rebecca L., et al. "Development of convergent synaptic inputs to subpopulations of autonomic neurons." Journal of Comparative Neurology 447.3 (2002): 218-233. Guinea Pig 6 11984817
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ma, Jian, et al. "Development of Layer 1 Neurons in the Mouse Neocortex." Cerebral Cortex (2013): bht114. Mouse IHC 3 23680842
20077 VIP (Vasoactive Intestinal Peptide) Antibody Robertson, G. N., et al. "Development of the swimbladder and its innervation in the zebrafish, Danio rerio." Journal of morphology 268.11 (2007): 967-985. Zebrafish IF 26 17702001
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Neurosci. 2011 Apr 27;31(17):6457-67. doi: 10.1523/JNEUROSCI.5385-10.2011. Development, maturation, and necessity of transcription factors in the mouse suprachiasmatic nucleus. VanDunk C1, Hunter LA, Gray PA. Mouse IF Transcription Factor 21525287
20077 VIP (Vasoactive Intestinal Peptide) Antibody Zilles, Karl, et al. "Developmental gradients of vasoactive intestinal polypeptide (VIP)-containing neurons in the rat visual cortex detected by image analysis." Developmental brain research 60.2 (1991): 137-144. Rat 7 1893563
20077 VIP (Vasoactive Intestinal Peptide) Antibody Brain Res. 1990 Oct 29;531(1-2):290-3. Dibutyryl cAMP stimulates analgesia in rats bearing a ventricular adrenal medulla transplant.Pacheco-Cano MT1, García-Hernández F, Hiriart M, Komisaruk BR, Drucker-Colín R. Rat 14 1963102
20077 VIP (Vasoactive Intestinal Peptide) Antibody Okishio, Yutaka, et al. "Differences in mediator of nonadrenergic, noncholinergic relaxation of the distal colon between Wistar Rat 20 10657552
20077 VIP (Vasoactive Intestinal Peptide) Antibody Takeuchi, Yoshitaka, et al. "Differences in the density of sympathetic nerve fibers in the arteriolar walls of the rat extensor digitorum longus muscle." Anatomical science international 77.1 (2002): 51-57. Rat 0 12418084
20077 VIP (Vasoactive Intestinal Peptide) Antibody Pidsudko, Z., et al. "Differences in the distribution and chemical coding between neurons in the inferior mesenteric ganglion supplying the colon and rectum in the pig." Cell and tissue research 303.2 (2001): 147-158. Pig 34 11291762
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cox, David J., and Claudia Racca. "Differential dendritic targeting of AMPA receptor subunit mRNAs in adult rat hippocampal principal neurons and interneurons." Journal of Comparative Neurology 521.9 (2013): 1954-2007. Rat ICC 2 23296627
20077 VIP (Vasoactive Intestinal Peptide) Antibody Huh, Youngbuhm, et al. "Differential effects of aging on NADPHdiaphorase and VIP neurons in cerebral cortex of rats." NeuroReport 8.13 (1997): 2991-2994. Rat IHC aging 13 9376544
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hill, David P., and Kent A. Robertson. "Differentiation of LA-N-5 neuroblastoma cells into cholinergic neurons: methods for differentiation, immunohistochemistry and reporter gene introduction." Brain Research Protocols 2.3 (1998): 183-190. IHC 18 9507116
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cesk Patol. 2013 Apr;49(2):99-102. Diffuse idiopathic pulmonary neuroendocrine cell hyperplasia: case report and review of literature. Dvořáčková J1, Mačák J, Buzrla P. IHC 1 23641717
20077 VIP (Vasoactive Intestinal Peptide) Antibody Abizaid, Alfonso, et al. "Direct visual and circadian pathways target neuroendocrine cells in primates." European Journal of Neuroscience 20.10 (2004): 2767-2776. Monkey IHC 12 15548220
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Neurosci. 2007 May 9;27(19):5012-22. Distinct cis-regulatory elements from the Dlx1/Dlx2 locus mark different progenitor cell populations in the ganglionic eminences and different subtypes of adult cortical interneurons. Ghanem N1, Yu M, Long J, Hatch G, Rubenstein JL, Ekker M. Mouse IHC 61 17494687
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawaguchi, Yasuo. "Distinct firing patterns of neuronal subtypes in cortical synchronized activities." The Journal of Neuroscience 21.18 (2001): 7261-7272. Rat 65 11549736
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hatanaka, Yumiko, et al. "Distinct migratory behavior of early?and late?born neurons derived from the cortical ventricular zone." Journal of Comparative Neurology 479.1 (2004): 1-14. Mouse IHC 66 15389616
20077 VIP (Vasoactive Intestinal Peptide) Antibody Pidsudko, Zenon. "Distribution and chemical coding of neurons in intramural ganglia of the porcine urinary bladder trigone." Folia Histochemica et Cytobiologica 42.1 (2004): 3-2. IHC 14 15046394
20077 VIP (Vasoactive Intestinal Peptide) Antibody Feher, Erzsebet, and Csaba Leranth. "Distribution and fine structure of the different neuropeptide-containing nerve elements of the small intestine." Neurovegetative control systems: basic functions, integration, and disorders: proceedings of the XIXth International Congress of Neurovegetative Research, Berlin (West), FRG, March 1984. Vol. 339. No. 343. Elsevier Publishing Company, 1986. 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Manger, Paul R., et al. "Distribution and putative function of autonomic nerve fibres in the bill skin of the platypus (Ornithorhynchus anatinus)." Philosophical Transactions of the Royal Society of London. Series B: Biological Sciences 353.1372 (1998): 1159-1170. Platypus IHC 11 9720112
20077 VIP (Vasoactive Intestinal Peptide) Antibody KUSAKABE, Tatsumi, and Tadashi KAWAKAMI. "Distribution of CGRP, Substance P VIP and Somatostatin Immunoreactive Nerve Fibers in the Internal Gills of Larvae of the Bullfrog, Rana ca tesbeiana." Arch. Histol. Cytol 55.3 (1992): 243-249. Bullfrog IHC 7 1384606
20077 VIP (Vasoactive Intestinal Peptide) Antibody Domoto, Tokio, et al. "Distribution of extrinsic enkephalin-containing nerve fibers in the rat rectum and their origin in the major pelvic ganglion." Journal of the autonomic nervous system 49.2 (1994): 135-146. Rat 5 7806766
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hisajima, Tatsuya, et al. "Distribution of myelinated and unmyelinated nerve fibers and their possible role in blood flow control in crotaline snake infrared receptor organs." Journal of Comparative Neurology 449.4 (2002): 319-329. Snake IF 3 12115668
20077 VIP (Vasoactive Intestinal Peptide) Antibody Doone, Garth V., et al. "Distribution of NADPH-d and nNOS-IR in the thoracolumbar and sacrococcygeal spinal cord of the guinea pig." Journal of the autonomic nervous system 77.2 (1999): 98-113. Guinea Pig IHC 16 11130968
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cell Tissue Res. 1993 Oct;274(1):181-7. Distribution of neuropeptides in the porcine stellate ganglion. Häppölä O1, Lakomy M, Majewski M, Wasowicz K, Yanaihara N. 13 7694801
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hamaji, Masayasu, et al. "Distribution of peptidergic terminals of enteric origin in the rat celiac ganglion." Neuroscience letters 102.2 (1989): 121-124. Rat 2 2682383
20077 VIP (Vasoactive Intestinal Peptide) Antibody Koike, Shinobu, et al. "Distribution of vanilloid receptors in the rat laryngeal innervation." Acta oto-laryngologica 124.4 (2004): 515-519. Rat 14 15224886
20077 VIP (Vasoactive Intestinal Peptide) Antibody Katahashi, Tatsuaki, et al. "Distribution of vasoactive intestinal polypeptide immunoreactive nerve fiber in the rat nasal mucosa." Auris Nasus Larynx 24.1 (1997): 59-64. Rat 5 9251856
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kaleczyc, Jerzy, et al. "Distribution, immunohistochemical characteristics and nerve pathways of primary sensory neurons supplying the porcine vas deferens." Cell and tissue research 310.1 (2002): 9-17. 37 12242479
20077 VIP (Vasoactive Intestinal Peptide) Antibody Perrenoud, Quentin, et al. "Diversity of GABAergic interneurons in layer VIa and VIb of mouse barrel cortex." Cerebral Cortex 23.2 (2013): 423-441. Mouse IHC 5 22357664
20077 VIP (Vasoactive Intestinal Peptide) Antibody Villanueva, Carine, Sandrine Jacquier, and Nicolas de Roux. "DLK1 is a somato-dendritic protein expressed in hypothalamic arginine-vasopressin and oxytocin neurons." PloS one 7.4 (2012): e36134. Mouse IHC 3 22563444
20077 VIP (Vasoactive Intestinal Peptide) Antibody Parent, Andre, and Brigitte Lavoie. "Dopaminergic innervation of the basal ganglia in normal and parkinsonian monkeys." Current Monkey parkinson 18 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Song, C. Kay, and Timothy J. Bartness. "Dorsocaudal SCN microknife-cuts do not block short day responses in Siberian hamsters given melatonin infusions." Brain research bulletin 45.3 (1998): 239-246. Hamster 13 9510416
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hughes, David I., et al. "Double immunofluorescence, peroxidase labelling and ultrastructural analysis of interneurones following prolonged electrophysiological recordings in vitro." Journal of neuroscience methods 101.2 (2000): 107-116. 28 10996371
20077 VIP (Vasoactive Intestinal Peptide) Antibody Shotton, Hannah R., Ashok Adams, and Jill Lincoln. "Effect of aminoguanidine treatment on diabetes-induced changes in the myenteric plexus of rat ileum." Autonomic Neuroscience 132.1 (2007): 16-26. Rat diabete 17 16987713
20077 VIP (Vasoactive Intestinal Peptide) Antibody KUSAKABE, TATSUMI, et al. "Effect of Carbon Dioxide on the Structure of the Carotid Body A comparison between normoxic and hypoxic conditions." THE ARTERIAL CHEMORECEPTORS. Springer US, 2006. 55-61. 1 16683698
20077 VIP (Vasoactive Intestinal Peptide) Antibody Shotton, H. R., J. Lincoln, and B. C. McGorum. "Effects of equine grass sickness on sympathetic neurons in prevertebral and paravertebral ganglia." Journal of comparative pathology 145.1 (2011): 35-44. IHC 0 21457994
20077 VIP (Vasoactive Intestinal Peptide) Antibody Meyer-Bernstein, Elizabeth L., et al. "Effects of Suprachiasmatic Transplants on Circadian Rhythms of Neuroendocrine Function in Golden Hamsters 1." Endocrinology 140.1 (1999): 207-218. Hamster ICC 173 9886827
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jobling, P. "Electrophysiological events during neuroeffector transmission in the spleen of guinea-pigs and rats." The Journal of physiology 476.1 (1994): 153-165. Guinea Pig, Rat IHC 10 7913966
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rizk, Sherif L., et al. "Elevated creatine phosphokinase MB in a patient with neuroendocrine carcinoma of the colon Tumor Markers 5 3359901
20077 VIP (Vasoactive Intestinal Peptide) Antibody Yamamoto, Ryo, et al. "Enhanced expression of nitric oxide synthase by rat retina following pterygopalatine parasympathetic denervation." Brain research 631.1 (1993): 83-88. Rat 44 7507791
20077 VIP (Vasoactive Intestinal Peptide) Antibody Arabadzisz, Dimitrula, et al. "Epileptogenesis and chronic seizures in a mouse model of temporal lobe epilepsy are associated with distinct EEG patterns and selective neurochemical alterations in the contralateral hippocampus." Experimental neurology 194.1 (2005): 76-90. Mouse 57 15899245
20077 VIP (Vasoactive Intestinal Peptide) Antibody Nozaki, Kazuhiko, et al. "Erythrocytes suppress calcitonin gene-related peptide-and vasoactive intestinal polypeptide-like immunoreactivities in cerebrovascular nerve fibers after subarachnoid hemorrhage." Neuroscience letters 110.1 (1990): 22-27. 8 2325886
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Comp Neurol. 2008 Nov 10;511(2):173-86. doi: 10.1002/cne.21830.Estradiol modulates neural responses to song in a seasonal songbird. Maney DL1, Goode CT, Lange HS, Sanford SE, Solomon BL. Sparrow IHC 18770869
20077 VIP (Vasoactive Intestinal Peptide) Antibody Landis, Story C., Ruth E. Siegel, and Martin Schwab. "Evidence for neurotransmitter plasticityin vivo: II. Immunocytochemical studies of rat sweat gland innervation during development." Developmental biology 126.1 (1988): 129-140. Rat 92 2893756
20077 VIP (Vasoactive Intestinal Peptide) Antibody Brinley-Reed, Margaret, and Alexander J. McDonald. "Evidence that dopaminergic axons provide a dense innervation of specific neuronal subpopulations in the rat basolateral amygdala." Brain research 850.1 (1999): 127-135. Rat 56 10629756
20077 VIP (Vasoactive Intestinal Peptide) Antibody Carnahan, Josette F., David J. Anderson, and Paul H. Patterson. "Evidence that enteric neurons may derive from the sympathoadrenal lineage." Developmental biology 148.2 (1991): 552-561. 44 1683841
20077 VIP (Vasoactive Intestinal Peptide) Antibody Park, Jung Cheol, et al. "Expression of GABA A receptor ?2/3 subunits in the rat major pelvic ganglion." Neuroscience letters 403.1 (2006): 35-39. Rat IHC 6 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ma, Yunfei, et al. "Expression of gap junction protein connexin36 in multiple subtypes of GABAergic neurons in adult rat somatosensory cortex." Cerebral cortex 21.11 (2011): 2639-2649. 15 21467210
20077 VIP (Vasoactive Intestinal Peptide) Antibody Duque, Alvaro, Valeswara, Rao Gazula, and Leonard K. Kaczmarek. "Expression of Kv1. 3 potassium channels regulates density of cortical interneurons." Developmental neurobiology 73.11 (2013): 841-855. Rat IHC 0 23821603
20077 VIP (Vasoactive Intestinal Peptide) Antibody Uyttebroek, Leen, et al. "Expression of neuropeptides and anoctamin 1 in the embryonic and adult zebrafish intestine, revealing neuronal subpopulations and ICC-like cells." Cell and tissue research 354.2 (2013): 355-370. Fish ICC 0 23881406
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vigers, Alison J., Zachary C. Baquet, and Kevin R. Jones. "Expression of neurotrophin-3 in the mouse forebrain: Insights from a targeted LacZ reporter." Journal of Comparative Neurology 416.3 (2000): 398-415. Mouse 44 10602097
20077 VIP (Vasoactive Intestinal Peptide) Antibody Zhang, Qin, et al. "Expression of pituitary adenylate cyclase-activating polypeptide in dorsal root ganglia following axotomy: time course and coexistence." Brain research 705.1 (1995): 149-158. IHC 91 8821745
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kalamatianos, Theodosis, et al. "Expression of VIP and/or PACAP receptor mRNA in peptide synthesizing cells within the suprachiasmatic nucleus of the rat and in its efferent target sites." Journal of Comparative Neurology 475.1 (2004): 19-35. Rat IHC 47 15176082
20077 VIP (Vasoactive Intestinal Peptide) Antibody Zhao, Fang-li, et al. "Expression, physiological action, and coexpression patterns of neuropeptide Y in rat taste-bud cells." Proceedings of the National Academy of Sciences of the United States of America 102.31 (2005): 11100-11105. Rat ICC 73 16040808
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vogelbaum, Michael A., Jennifer Galef, and Michael Menaker. "Factors determining the restoration of circadian behavior by hypothalamic transplants." Neural Plasticity 4.4 (1993): 239-256. ICC 9 7948176
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cheung, C. Y., and M. A. Holzwarth. "Fetal adrenal VIP: distribution and effect on medullary catecholamine secretion." Peptides 7.3 (1986): 413-418. ICC 28 3534807
20077 VIP (Vasoactive Intestinal Peptide) Antibody Li, Hua, and Evelyn Satinoff. "Fetal tissue containing the suprachiasmatic nucleus restores multiple circadian rhythms in old rats." American Journal of Physiology-Regulatory, Integrative and Comparative Physiology 275.6 (1998): R1735-R1744. Rat 41 9843862
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lehman, Michael N., J. Lesauter, and Rae Silver. "Fiber outgrowth from anterior hypothalamic and cortical xenografts in the third ventricle." Journal of Comparative Neurology 391.1 (1998): 133. Rat, Hamster ICC 13 9527538
20077 VIP (Vasoactive Intestinal Peptide) Antibody Repetti, C. F., W. A. Baughman, and V. Shanabrook. "Flow cytometric characterization of a distinct presentation of 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Krajnak, Kristine, Katherine L. Rosewell, and Phyllis M. Wise. "Fos-induction in gonadotropin-releasing hormone neurons receiving vasoactive intestinal polypeptide innervation is reduced in middle-aged female rats." Biology of reproduction 64.4 (2001): 1160-1164. Rat ICC 34 11259263
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gastroenterology. 2009 Dec;137(6):2052-62. doi: 10.1053/j.gastro.2009.08.059. Epub 2009 Sep 6. Foxa1 and Foxa2 control the differentiation of goblet and enteroendocrine L- and D-cells in mice. Ye DZ1, Kaestner KH. Mouse IHC 19737569
20077 VIP (Vasoactive Intestinal Peptide) Antibody Shepherd, Stacie P., and Matilde A. Holzwarth. "Frog chromaffin and Adrenocortical Cell Co?Cultures: A Model for the Study of Medullary Control of Corticosteroidogenesis." Journal of neuroendocrinology 10.7 (1998): 539-549. Frog ICC 11 9700681
20077 VIP (Vasoactive Intestinal Peptide) Antibody Front Neural Circuits. 2012 Sep 24;6:66. eCollection 2012. Functional adaptation of cortical interneurons to attenuated activity is subtype-specific. Karayannis T1, De Marco García NV, Fishell GJ Mouse IHC 3 23015781
20077 VIP (Vasoactive Intestinal Peptide) Antibody von Engelhardt, Jakob, et al. "Functional characterization of intrinsic cholinergic interneurons in the cortex." The Journal of neuroscience 27.21 (2007): 5633-5642. Mouse IHC 54 17522308
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jobling, Phillip, Ian L. Gibbins, and Judy L. Morris. "Functional organization of vasodilator neurons in pelvic ganglia of female guinea pigs: comparison with uterine motor neurons." Journal of Comparative Neurology 459.3 (2003): 223-241. Guinea Pig 14 12655506
20077 VIP (Vasoactive Intestinal Peptide) Antibody Dougalis, Antonios G., et al. "Functional properties of dopamine neurons and co?expression of vasoactive intestinal polypeptide in the dorsal raphe nucleus and ventro?lateral periaqueductal grey." European Journal of Neuroscience 36.10 (2012): 3322-3332. Mouse IHC 2 22925150
20077 VIP (Vasoactive Intestinal Peptide) Antibody Muller, J. M., et al. "Functional vasoactive intestinal polypeptide (VIP) receptors in human neuroblastoma subclones that contain VIP precursor mRNA and release VIP-like substances." Journal of Biological Chemistry 264.7 (1989): 3647-3650. Human 47 2537287
20077 VIP (Vasoactive Intestinal Peptide) Antibody Fu, Cary, et al. "GABAergic interneuron development and function is modulated by the Tsc1 gene." Cerebral cortex 22.9 (2012): 2111-2119. Mouse IHC 27 22021912
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kummer, W. "Galanin-and neuropeptide Y-like immunoreactivities coexist in paravertebral sympathetic neurones of the cat." Neuroscience letters 78.2 (1987): 127-131. Cat 68 2442671
20077 VIP (Vasoactive Intestinal Peptide) Antibody Konopka, L. M., V. May, and C. J. Forehand. "Galanin?like innervation of rat submandibular and sublingual salivary glands: Origin and effect on acinar cell membranes." Journal of Comparative Neurology 317.3 (1992): 271-282. Rat 18 1374439
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tanaka, Yasumasa, Yoshikazu Yoshida, and Minoru Hirano. "Ganglionic neurons in vagal and laryngeal nerves projecting to larynx, and their peptidergic features in the cat." Acta Oto-Laryngologica 113.S506 (1993): 61-66. Cat IHC 6 7504864
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gamble, Karen L., et al. "Gastrin-releasing peptide mediates light-like resetting of the suprachiasmatic nucleus circadian pacemaker through cAMP response element-binding protein and Per1 activation." The Journal of Neuroscience 27.44 (2007): 12078-12087. IHC 45 17978049
20077 VIP (Vasoactive Intestinal Peptide) Antibody Batista-Brito, Renata, et al. "Gene expression in cortical interneuron precursors is prescient of their mature function." Cerebral Cortex 18.10 (2008): 2306-2317. Mouse IHC 54 18250082
20077 VIP (Vasoactive Intestinal Peptide) Antibody Donadio, V., et al. "Generalised anhidrosis: different lesion sites demonstrated by microneurography and skin biopsy." Journal of Neurology, Neurosurgery & Psychiatry 76.4 (2005): 588-591. Human 12 15774454
20077 VIP (Vasoactive Intestinal Peptide) Antibody Miyoshi, Goichi, et al. "Genetic fate mapping reveals that the caudal ganglionic eminence produces a large and diverse population of superficial cortical interneurons." The Journal of Neuroscience 30.5 (2010): 1582-1594. 135 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sienkiewicz, W., et al. "Has Active Immunization Against Gonadotrophin?Releasing Hormone any Effect on Testis Innervation in the Pig? Pig IHC 7 11008373
20077 VIP (Vasoactive Intestinal Peptide) Antibody Grimes, Patricia A., et al. "Helospectin-like immunoreactivity in the rat eye and pterygopalatine ganglion." Neuroscience letters 183.1 (1995): 108-111. Rat IHC 2 7746466
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gibbins, Ian L., et al. "Heterogeneous expression of SNAP?25 and synaptic vesicle proteins by central and peripheral inputs to sympathetic neurons." Journal of Comparative Neurology 459.1 (2003): 25-43. Guinea Pig 20 12629665
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Comp Neurol. 2008 Feb 1;506(4):708-32. Heterogeneous expression of gamma-aminobutyric acid and gamma-aminobutyric acid-associated receptors and transporters in the rat suprachiasmatic nucleus. Belenky MA1, Yarom Y, Pickard GE. Rat ICC 41 18067149
20077 VIP (Vasoactive Intestinal Peptide) Antibody Domoto, Tokio, et al. "Heterogenous distribution of peptide-containing nerve fibres within the circular muscle layer of the human pylorus." Clinical Autonomic Research 2.6 (1992): 403-407. Human IHC 11 1283961
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sirigu, P., et al. "Histochemical study of the human bulbourethral (Cowper's) glands." Andrologia 25.5 (1993): 293-299. Human IHC 11 7504419
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sirigu, P., et al. "Histochemistry of human urethral glands." Systems Biology in Reproductive Medicine 26.1 (1991): 43-51. Human IHC 3 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ibanez, Marta, et al. "Human laryngeal ganglia contain both sympathetic and parasympathetic cell types." Clinical Anatomy 23.6 (2010): 673-682. Human IHC 4 20821402
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ulrich-Lai, Yvonne M., and William C. Engeland. "Hyperinnervation during adrenal regeneration influences the rate of functional recovery." Neuroendocrinology 71.2 (2000): 107-123. 41 10686525
20077 VIP (Vasoactive Intestinal Peptide) Antibody Luff, Susan E., Simone B. Young, and Elspeth M. McLachlan. "Hyperinnervation of mesenteric arteries in spontaneously hypertensive rats by sympathetic but not primary afferent axons." Journal of vascular research 42.4 (2005): 348-358. Rat IHC 17 16015033
20077 VIP (Vasoactive Intestinal Peptide) Antibody Eilam, R., et al. "Hypertension induced by hypothalamic transplantation from genetically hypertensive to normotensive rats." The Journal of neuroscience 11.2 (1991): 401-411. Rat 68 1992008
20077 VIP (Vasoactive Intestinal Peptide) Antibody Van den Pol, A. N., et al. "Hypothalamic expression of a novel gene product, VGF: immunocytochemical analysis." The Journal of neuroscience 9.12 (1989): 4122-4137. Rat 73 2556505
20077 VIP (Vasoactive Intestinal Peptide) Antibody Komitova, Mila, et al. "Hypoxia-Induced Developmental Delays of Inhibitory Interneurons Are Reversed by Environmental Enrichment in the Postnatal Mouse Forebrain." The Journal of Neuroscience 33.33 (2013): 13375-13387. Mouse IHC Hypoxia 3 23946395
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, Tatsumi, et al. "Hypoxic adaptation of the peptidergic innervation in the rat carotid body." Brain research 806.2 (1998): 165-174. Rat 31 9739132
20077 VIP (Vasoactive Intestinal Peptide) Antibody Al-Shawaf, A. A., MARION D. Kendall, and T. I. M. O. T. H. Y. Cowen. "Identification of neural profiles containing vasoactive intestinal polypeptide, acetylcholinesterase and catecholamines in the rat thymus." Journal of anatomy 174 (1991): 131. Rat IHC 45 1827784
20077 VIP (Vasoactive Intestinal Peptide) Antibody Knight, D. S., R. D. Fabre, and J. A. Beal. "Identification of noradrenergic nerve terminals immunoreactive for neuropeptide Y and vasoactive intestinal peptide in the rat kidney." American journal of anatomy 184.3 (1989): 190-204. Rat 27 2568749
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Comp Neurol. 2010 Feb 1;518(3):389-404. doi: 10.1002/cne.22229. Immunochemical characterization of inhibitory mouse cortical neurons: three chemically distinct classes of inhibitory cells. Xu X1, Roby KD, Callaway EM. Mouse IF 19950390
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cell Tissue Res. 1991 Mar;263(3):541-8. Immunocytochemical and ultrastructural characterization of endocrine cells in chicken proventriculus. Martínez A1, López J, Barrenechea MA, Sesma P. Chicken 22 1678989
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vater, Marianne, M. K, Immunocytochemical aspects of the functional organization of the horseshoe bat's cochlear nucleus. Bat 3 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gen Comp Endocrinol. 2002 Sep;128(2):149-52. Immunocytochemical detection of leptin in non-mammalian vertebrate stomach. Muruzábal FJ1, Frühbeck G, Gómez-Ambrosi J, Archanco M, Burrell MA. 46 12392688
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ahnaou, Abdel, et al. "Immunocytochemical distribution of VIP and PACAP in the rat brain stem." Annals of the New York Academy of Sciences 1070.1 (2006): 135-142. Rat 9 16888155
20077 VIP (Vasoactive Intestinal Peptide) Antibody Nahin, R. L. "Immunocytochemical identification of long ascending peptidergic neurons contributing to the spinoreticular tract in the rat." Neuroscience 23.3 (1987): 859-869. Rat IHC 39 2449636
20077 VIP (Vasoactive Intestinal Peptide) Antibody Nahin, Richard L. "Immunocytochemical identification of long ascending, peptidergic lumbar spinal neurons terminating in either the medial or lateral thalamus in the rat." Brain Research 443.1 (1988): 345-349. Rat IHC 47 2896057
20077 VIP (Vasoactive Intestinal Peptide) Antibody McDonald, Alexander J., Franco Mascagni, and Jay F. Muller. "Immunocytochemical localization of GABA B R1 receptor subunits in the basolateral amygdala." Brain research 1018.2 (2004): 147-158. 25 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sloviter, Robert S., and Gajanan Nilaver. "Immunocytochemical localization of GABA?, cholecystokinin?, vasoactive intestinal polypeptide?, and somatostatin?like immunoreactivity in the area dentata and hippocampus of the rat." Journal of Comparative Neurology 256.1 (1987): 42-60. Rat 316 3819038
20077 VIP (Vasoactive Intestinal Peptide) Antibody Laemle, Lois K., and John R. Cotter. "Immunocytochemical localization of vasoactive intestinal polypeptide (VIP) in the brain of the little brown bat (Myotis lucifugus)." Journal of neurocytology 17.1 (1988): 117-129. Bat ICC 7 3047320
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rajjo, Ibrahim M., Steven R. Vigna, and Joe W. Crim. "Immunocytochemical localization of vasoactive intestinal polypeptide in the digestive tracts of a holostean and a teleostean fish." Comparative Biochemistry and Physiology Part C: Comparative Pharmacology 94.2 (1989): 411-418. Fish 3 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Calka, Jaroslaw. "Immunocytochemical localization of VIP-immunoreactive neurons in the hypothalamus of immature gilts." Neuroscience letters 136.2 (1992): 177-180. 4 1641186
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lopez, J., et al. "Immunocytochemical study of the lung of domestic fowl and pigeon: endocrine cells and nerves." Cell and tissue research 273.1 (1993): 89-95. Pigeon, Fowl 8 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Welton, Joan, et al. "Immunocytochemical survey of putative neurotransmitters in taste buds from Necturus maculosus." Journal of Comparative Neurology 324.4 (1992): 509-521. Mudpuppy (Necturus Maculosus) 27 1385495
20077 VIP (Vasoactive Intestinal Peptide) Antibody Wadhwa, Shashi, and Geeta Jotwani. "Immunohistochemical analysis of glutamate, cholecystokinin and vasoactive intestinal polypeptide in the lateral geniculate complex of albino rat: A developmental study." Journal of biosciences 18.2 (1993): 229-238. Rat 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Mascagni, Franco, and Alexander J. McDonald. "Immunohistochemical characterization of cholecystokinin containing neurons in the rat basolateral amygdala." Brain research 976.2 (2003): 171-184. Rat 74 12763251
20077 VIP (Vasoactive Intestinal Peptide) Antibody McDonald, Alexander J., and Franco Mascagni. "Immunohistochemical characterization of somatostatin containing interneurons in the rat basolateral amygdala." Brain research 943.2 (2002): 237-244. Rat 93 12101046
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lopes, M. B. S., et al. "Immunohistochemical characterization of subependymal giant cell astrocytomas." Acta neuropathologica 91.4 (1996): 368-375. Human IHC 64 8928613
20077 VIP (Vasoactive Intestinal Peptide) Antibody Heym, Christine, et al. "Immunohistochemical correlation of human adrenal nerve fibres and thoracic dorsal root neurons with special reference to substance P." Histochemistry and cell biology 104.3 (1995): 233-243. Human 15 8542449
20077 VIP (Vasoactive Intestinal Peptide) Antibody Reuss, Stefan, et al. "Immunohistochemical evidence for the presence of neuropeptides in the hypothalamic suprachiasmatic nucleus of ground squirrels." The Anatomical Record 225.4 (1989): 341-346. Squirrel 23 2589647
20077 VIP (Vasoactive Intestinal Peptide) Antibody Heym, Christine, et al. "Immunohistochemical evidence from co-localization and denervation studies for four types of substance P-containing nervous structures in the rat superior cervical ganglion." Anatomy and embryology 187.5 (1993): 485-492. Rat IHC 7 7688195
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hoyle, C. H. V., et al. "Immunohistochemical localisation of neuropeptides and nitric oxide synthase in sural nerves from Egyptian mummies." Journal of the autonomic nervous system 67.1 (1997): 105-108. 10 9470150
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, T., et al. "Immunohistochemical localisation of regulatory neuropeptides in human circumvallate papillae." Journal of anatomy 192.4 (1998): 557-564. Human IHC 34 9723982
20077 VIP (Vasoactive Intestinal Peptide) Antibody Dai, X. L., J. Triepel, and Ch Heym. "Immunohistochemical localization of neuropeptide Y in the guinea pig medulla oblongata." Histochemistry 85.4 (1986): 327-334. Guinea Pig 14 3531106
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lakomy, M., et al. "Immunohistochemical Localization of Neuropeptides in the Porcine Thoraco?Lumbar Paravertebral Ganglia." Anatomia, histologia, embryologia 23.1 (1994): 12-20. 8 7943753
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ball, Gregory F., et al. "Immunohistochemical localization of neuropeptides in the vocal control regions of two songbird species." Journal of Comparative Neurology 268.2 (1988): 171-180. 55 2452178
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Comp Neurol. 1983 Feb 1;213(4):414-25. Immunohistochemical studies on the distribution and origin of candidate peptidergic primary afferent neurotransmitters in the spinal cord of an elasmobranch fish, the Atlantic stingray (Dasyatis sabina). Ritchie TC, Leonard RB. Sting Ray IHC 6187783
20077 VIP (Vasoactive Intestinal Peptide) Antibody Iwata, Tsuyoshi, et al. "Immunohistochemical studies on the distribution of nerve fibers in the human prostate with special reference to the anterior fibromuscular stroma." The Prostate 48.4 (2001): 242-247. Human IHC 15 11536303
20077 VIP (Vasoactive Intestinal Peptide) Antibody Soinila, Seppo, and George J. Mpitsos. "Immunohistochemistry of diverging and converging neurotransmitter systems in mollusks." The Biological Bulletin 181.3 (1991): 484-499. Mollusk 40 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ueyama, Teizo, et al. "Immunolocalization of tyrosine hydroxylase and vasoactive intestinal polypeptide in nerve fibers innervating human palatine tonsil and paratonsillar glands." Neuroscience letters 116.1 (1990): 70-74. Human IHC 12 1979667
20077 VIP (Vasoactive Intestinal Peptide) Antibody Doetsch, Gernot S., et al. "Immunoreactivity for GAD and three peptides in somatosensory cortex and thalamus of the raccoon." Brain research bulletin 31.5 (1993): 553-563. Raccoon ICC 11 8098654
20077 VIP (Vasoactive Intestinal Peptide) Antibody Stone, Richard A., et al. "Increase in retinal vasoactive intestinal polypeptide after eyelid fusion in primates." Proceedings of the National Academy of Sciences 85.1 (1988): 257-260. 111 2448769
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ueno, Eri, et al. "Increased migration of IgA lymphocytes to VIP nerve fibers after DSS-induced colitis." Histology and histopathology 26.10 (2011): 1317. ulcerative colitis 0 21870335
20077 VIP (Vasoactive Intestinal Peptide) Antibody Asmus, Stephen E., et al. "Increasing proportions of tyrosine hydroxylase-immunoreactive interneurons colocalize with choline acetyltransferase or vasoactive intestinal peptide in the developing rat cerebral cortex." Brain research 1383 (2011): 108-119. Fish IF 2 21295554
20077 VIP (Vasoactive Intestinal Peptide) Antibody PLoS Genet. 2007 Feb 23;3(2):e33. Epub 2007 Jan 5.Inducible and reversible Clock gene expression in brain using the tTA system for the study of circadian behavior. Hong HK1, Chong JL, Song W, Song EJ, Jyawook AA, Schook AC, Ko CH, Takahashi JS. Mouse IF 17319750
20077 VIP (Vasoactive Intestinal Peptide) Antibody Reinert, A., A. Kaske, and S. Mense. "Inflammation-induced increase in the density of neuropeptide-immunoreactive nerve endings in rat skeletal muscle." Experimental brain research 121.2 (1998): 174-180. Rat 83 9696386
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hill, Bethan, et al. "Innervation and nitric oxide modulation of mesenteric arteries of the Golden hamster." European journal of pharmacology 317.2 (1996): 275-283. Hamster IHC 17 8997611
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Neurocytol. 1987 Apr;16(2):155-67. Innervation and reinnervation of rat inferior olive by neurons containing serotonin and substance P: an immunohistochemical study after 5,6-dihydroxytryptamine lesioning. Paré M, Descarries L, Wiklund L. 14 2442314
20077 VIP (Vasoactive Intestinal Peptide) Antibody Dail, William G., Ysela Carrillo, and Guy Walton. "Innervation of the anococcygeus muscle of the rat." Cell and tissue research 259.1 (1990): 139-146. Rat IHC 30 2297780
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keast, J. R. "Innervation of the monotreme gastrointestinal tract: a study of peptide and catecholamine distribution." Journal of Comparative Neurology 334.2 (1993): 228-240. IHC 5 8103529
20077 VIP (Vasoactive Intestinal Peptide) Antibody Steele, Penelope A., and Julia K. Choate. "Innervation of the pacemaker in guinea-pig sinoatrial node." Journal of the autonomic nervous system 47.3 (1994): 177-187. Guinea Pig IHC 19 8014378
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kendall, Marion D., and Ali A. Al-Shawaf. "Innervation of the rat thymus gland." Brain, behavior, and immunity 5.1 (1991): 9-28. Rat 116 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hoyle, C. H., et al. "Innervation of vasculature and microvasculature of the human vagina by NOS and neuropeptide-containing nerves." Journal of anatomy 188.Pt 3 (1996): 633. Human 160 8763480
20077 VIP (Vasoactive Intestinal Peptide) Antibody Saldanha, Colin J., and Rae Silver. "Intraventricular Prolactin Inhibits Hypothalamic Vasoactive?Intestinal Polypeptide?Expression in Doves." Journal of neuroendocrinology 7.11 (1995): 881-887. Doves ICC 5 8748126
20077 VIP (Vasoactive Intestinal Peptide) Antibody Peptides. 2003 Sep;24(9):1397-402. Effects of PKA modulation on the expression of neuropeptide Y in rat amygdaloid structures during ethanol withdrawal.Zhang H1, Pandey SC. IHC 12 9786173
20077 VIP (Vasoactive Intestinal Peptide) Antibody Histol Histopathol. 2000 Oct;15(4):1093-105. Intrinsic innervation in the intestine of the lizard Podarcis hispanica. Martinez-Ciriano C1, Junquera C, Castiella T, Gomez-Barrena E, Aisa J, Blasco J. Lizard 7 11005234
20077 VIP (Vasoactive Intestinal Peptide) Antibody Webb, Alexis B., et al. "Intrinsic, nondeterministic circadian rhythm generation in identified mammalian neurons." Proceedings of the National Academy of Sciences 106.38 (2009): 16493-16498. Mouse IF 63 19805326
20077 VIP (Vasoactive Intestinal Peptide) Antibody Shibata, Shigenobu, et al. "Involvement of vasoactive intestinal polypeptide in NMDA-induced phase delay of firing activity rhythm in the suprachiasmatic nucleus in vitro." Neuroscience & Biobehavioral Reviews 18.4 (1995): 591-595. 22 7708374
20077 VIP (Vasoactive Intestinal Peptide) Antibody Niioka, Takeharu, Hisayoshi Ishii, and Hiroshi Izumi. "Involvement of vasoactive intestinal polypeptide in the parasympathetic vasodilatation of the rat masseter muscle." Archives of oral biology 54.10 (2009): 909-916. Rat 3 19647228
20077 VIP (Vasoactive Intestinal Peptide) Antibody El Kafi, B., et al. "Is the nucleus raphe dorsalis a target for the peptides possessing hypnogenic properties?." Brain research 637.1 (1994): 211-221. 43 8180798
20077 VIP (Vasoactive Intestinal Peptide) Antibody Donadio, V., et al. "Isolated generalised anhidrosis induced by postganglionic sympathetic skin nerve fibre degeneration: an incomplete Ross syndrome?." Journal of Neurology, Neurosurgery & Psychiatry 79.8 (2008): 959-961. 6 18356251
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Neurosci. 2009 Jan 7;29(1):70-85. doi: 10.1523/JNEUROSCI.4104-08.2009. Laminar specificity of functional input to distinct types of inhibitory cortical neurons. Xu X1, Callaway EM. Mouse IHC 19129386
20077 VIP (Vasoactive Intestinal Peptide) Antibody De Lacalle, Sonsoles, Sunita Kulkarni, and Ronald G. Wiley. "Lesion?induced transneuronal plasticity of the cholinergic innervation in the adult rat entorhinal cortex." European Journal of Neuroscience 10.3 (1998): 1054-1062. Rat 14 9753173
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kado, Masanori, et al. "Light and electron microscopic immunocytochemical study on the innervation of the pineal gland of the tree shrew (Tupaia glis), with special reference to peptidergic synaptic junctions with pinealocytes." Brain research 842.2 (1999): 359-375. Shrew 12 10526132
20077 VIP (Vasoactive Intestinal Peptide) Antibody Aronin, Neil, et al. "Light regulates expression of a Fos-related protein in rat suprachiasmatic nuclei." Proceedings of the National Academy of Sciences 87.15 (1990): 5959-5962. Rat IHC 299 2116012
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kummer, W., and J-O. Habeck. "Light-and Electronmicroscopical Immunohistochemical Investigation of the Innervation of the Human Carotid Body." Neurobiology and Cell Physiology of Chemoreception. Springer US, 1993. 67-71. Human 1 7509114
20077 VIP (Vasoactive Intestinal Peptide) Antibody Castel, Mona, et al. "Light-induced c-Fos expression in the mouse suprachiasmatic nucleus: immunoelectron microscopy reveals co?localization in multiple cell types." European Journal of Neuroscience 9.9 (1997): 1950-1960. Mouse 51 9383218
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawahito, Y. U. T. A. K. A., et al. "Local secretion of corticotropin-releasing hormone by enterochromaffin cells in human colon." Gastroenterology 106.4 (1994): 859-865. Human ICC 97 7511553
20077 VIP (Vasoactive Intestinal Peptide) Antibody LeSauter, J., and Rae Silver. "Localization of a suprachiasmatic nucleus subregion regulating locomotor rhythmicity." The Journal of neuroscience 19.13 (1999): 5574-5585. Hamster IHC 113 10377364
20077 VIP (Vasoactive Intestinal Peptide) Antibody McDonald, Alexander J. "Localization of AMPA glutamate receptor subunits in subpopulations of non-pyramidal neurons in the rat basolateral amygdala." Neuroscience letters 208.3 (1996): 175-178. Rat 38 8733298
20077 VIP (Vasoactive Intestinal Peptide) Antibody Bottjer, Sarah W., and Gail Alexander. "Localization of met-enkephalin and vasoactive intestinal polypeptide in the brains of male zebra finches (Part 1 of 2)." Brain, behavior and evolution 45.3 (1995): 153-165. Zebra Finch (Bird) IHC 49 7796094
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vizzard, Margaret A., et al. "Localization of NADPH diaphorase in the lumbosacral spinal cord and dorsal root ganglia of the cat." Journal of Comparative Neurology 339.1 (1994): 62-75. Cat ICC 88 8106662
20077 VIP (Vasoactive Intestinal Peptide) Antibody Dartt, Darlene A., et al. "Localization of nerves adjacent to goblet cells in rat conjunctiva." Current eye research 14.11 (1995): 993-1000. Rat 47 8585938
20077 VIP (Vasoactive Intestinal Peptide) Antibody Li, Hai-Biao, and Dominic Man-Kit Lam. "Localization of neuropeptide-immunoreactive neurons in the human retina." Brain research 522.1 (1990): 30-36. Human 28 1699634
20077 VIP (Vasoactive Intestinal Peptide) Antibody Smith, Matthew J., Lothar Jennes, and Phyllis M. Wise. "Localization of the VIP2 receptor protein on GnRH neurons in the female rat." Endocrinology 141.11 (2000): 4317-4320. Rat 48 11089568
20077 VIP (Vasoactive Intestinal Peptide) Antibody Dail, W. G., M. A. Moll, and K. Weber. "Localization of vasoactive intestinal polypeptide in penile erectile tissue and in the major pelvic ganglion of the rat." Neuroscience 10.4 (1983): 1379-1386. Rat 86 6363967
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keast, Janet R. "Location and peptide content of pelvic neurons supplying the muscle and lamina propria of the rat vas deferens." Journal of the autonomic nervous system 40.1 (1992): 1-11. Rat ICC 64 1401723
20077 VIP (Vasoactive Intestinal Peptide) Antibody Nangle, Matthew R., and Janet R. Keast. "Loss of nitrergic neurotransmission to mouse corpus cavernosum in the absence of neurturin is accompanied by increased response to acetylcholine." British journal of pharmacology 148.4 (2006): 423-433. Mouse IHC 12 16682963
20077 VIP (Vasoactive Intestinal Peptide) Antibody Diebold, Yolanda, et al. "Lymphocytic infiltration and goblet cell marker alteration in the conjunctiva of the MRL/MpJ-Faslpr mouse model of Sj 4 17208228
20077 VIP (Vasoactive Intestinal Peptide) Antibody Khorsand, Jila, Ruth L. Katz, and Niramol Savaraj. "Malignant carcinoid of the pancreas: A cytologic, ultrastructural, and immunocytochemical study of a case diagnosed by fine?needle aspiration of a supraclavicular node metastasis." Diagnostic cytopathology 3.3 (1987): 222-226. 8 3311666
20077 VIP (Vasoactive Intestinal Peptide) Antibody Roth, Kevin A., Jennifer M. Hertz, and Jeffrey I. Gordon. "Mapping enteroendocrine cell populations in transgenic mice reveals an unexpected degree of complexity in cellular differentiation within the gastrointestinal tract." The Journal of cell biology 110.5 (1990): 1791-1801. Mouse ICC 98 2186049
20077 VIP (Vasoactive Intestinal Peptide) Antibody Spong, Catherine Y., et al. "Maternal Regulation of Embryonic Growth: The Role of Vasoactive Intestinal Peptide 1." Endocrinology 140.2 (1999): 917-924. IHC 44 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keast, J. R., et al. "Maturational and maintenance effects of testosterone on terminal axon density and neuropeptide expression in the rat vas deferens." Neuroscience 112.2 (2002): 391-398. Rat 28 12044456
20077 VIP (Vasoactive Intestinal Peptide) Antibody Martinez, A., A. C. Villaro, and P. Sesma. "Microscopic study of the pyloric caeca of the starfish Marthasterias glacialis (Echinodermata): finding of endocrine cells." Journal of Morphology 202.2 (1989): 151-164. Starfish 10 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tuncdemir, Sebnem N., Gord Fishell, and Renata Batista-Brito. "miRNAs are Essential for the Survival and Maturation of Cortical Interneurons." Cerebral Cortex (2014): bht426. Mouse IHC 0 24451661
20077 VIP (Vasoactive Intestinal Peptide) Antibody Toda, Megumi, et al. "Modulation by neurogenic acetylcholine of nitroxidergic nerve function in porcine ciliary arteries." Investigative ophthalmology & visual science 38.11 (1997): 2261-2269. Pig 24 9344349
20077 VIP (Vasoactive Intestinal Peptide) Antibody PLoS One. 2010 Dec 31;5(12):e15915. doi: 10.1371/journal.pone.0015915. Molecular and electrophysiological characterization of GFP-expressing CA1 interneurons in GAD65-GFP mice. Wierenga CJ1, Müllner FE, Rinke I, Keck T, Stein V, Bonhoeffer T. Mouse IF 21209836
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kosaka, T., C. W. Heizmann, and C. J. Barnstable. "Monoclonal antibody VC1. 1 selectively stains a population of GABAergic neurons containing the calcium-binding protein parvalbumin in the rat cerebral cortex." Experimental brain research 78.1 (1989): 43-50. Rat 35 2591517
20077 VIP (Vasoactive Intestinal Peptide) Antibody Aguilar-Roblero R1, Shibata S, Speh JC, Drucker-Colín R, Moore RY., Brain Res. 1992 May 15;580(1-2):288-96. "Morphological and functional development of the suprachiasmatic nucleus in transplanted fetal hypothalamus" 24 1504806
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, T., et al. "Morphological changes in the rat carotid body 1, 2, 4, and 8 weeks after the termination of chronically hypocapnic hypoxia." (2004). Rat Hypoxia 16 15375756
20077 VIP (Vasoactive Intestinal Peptide) Antibody Aguilar-Roblero R1, Morin LP, Moore RY, "Morphological correlates of circadian rhythm restoration induced by transplantation of the suprachiasmatic nucleus in hamsters" Hamster 39 7867754
20077 VIP (Vasoactive Intestinal Peptide) Antibody CASTEL, MONA, and JOHN F. MORRIS. "Morphological heterogeneity of the GABAergic network in the suprachiasmatic nucleus, the brain's circadian pacemaker." Journal of anatomy 196.1 (2000): 1-13. Rat, Mouse ICC 72 10697283
20077 VIP (Vasoactive Intestinal Peptide) Antibody SHIMAZAKI, TAKATSUGU, YOSHIKAZU YOSHIDA, and MINORU HIRANO. "Morphological study of the intrapharyngeal ganglia and ganglionic neurons in cats." Acta oto-laryngologica 118.1 (1998): 131-137. Cat 5 9504177
20077 VIP (Vasoactive Intestinal Peptide) Antibody Theriault, Elizabeth, and Dennis Landis. "Morphology of striatal neurons containing VIP?like immunoreactivity." Journal of Comparative Neurology 256.1 (1987): 1-13. 31 2434535
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Comp Neurol. 2006 Nov 1;499(1):144-60. Mouse cortical inhibitory neuron type that coexpresses somatostatin and calretinin. Xu X1, Roby KD, Callaway EM. Mouse IF 16958092
20077 VIP (Vasoactive Intestinal Peptide) Antibody Siegel, R. E., L. E. Eiden, and R. M. Pruss. "Multiple populations of neuropeptide-containing cells in cultures of the bovine adrenal medulla." Developmental Brain Research 17.1 (1985): 267-270. IHC 21 3886081
20077 VIP (Vasoactive Intestinal Peptide) Antibody Steele, P. A., et al. "Multiple populations of neuropeptide-containing intrinsic neurons in the guinea-pig heart." Neuroscience 62.1 (1994): 241-250. Guinea Pig IHC 103 7816202
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ellenberger, H. H., et al. "Multiple putative neuromessenger inputs to the phrenic nucleus in rat." Journal of Chemical Neuroanatomy 5.5 (1992): 375-382. Rat 22 1384555
20077 VIP (Vasoactive Intestinal Peptide) Antibody Silver, Rae, et al. "Multiple regulatory elements result in regional specificity in circadian rhythms of neuropeptide expression in mouse SCN." Neuroreport 10.15 (1999): 3165-3174. Mouse 71 10574554
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lamanna, C., et al. "NADPH-diaphorase and NOS enzymatic activities in some neurons of reptilian gut and their relationships with two neuropeptides." Anatomy and embryology 199.5 (1999): 397-405. IHC 22 10221451
20077 VIP (Vasoactive Intestinal Peptide) Antibody Costagliola, A., et al. "NADPH-diaphorase-, nitric oxide synthase-and VIP-containing nerve structures in the hen oviduct: a histochemical and immunohistochemical study." Archives of histology and cytology 60 (1997): 245-256. Hen IHC 19 9376172
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kubota, Yoshiyuki, et al. "Neocortical inhibitory terminals innervate dendritic spines targeted by thalamocortical afferents." The Journal of neuroscience 27.5 (2007): 1139-1150. Rat IHC 61 17267569
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sherman, Gordon F., et al. "Neocortical VIP neurons are increased in the hemisphere containing focal cerebrocortical microdysgenesis in New Zealand Black mice." Brain research 532.1 (1990): 232-236. Mouse 23 2282516
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keith, Ingegerd M., J. Jin, and R. Saban. "Nerve-mast cell interaction in normal guinea pig urinary bladder." Journal of Comparative Neurology 363.1 (1995): 28-36. Guinea Pig IHC 53 8682935
20077 VIP (Vasoactive Intestinal Peptide) Antibody VORTSEPNEVA, ELENA, ALEXANDER TZETLIN, and EUGENI TSITRIN. "Nervous system of the dwarf ectoparasitic male of Scolelepis laonicola (Polychaeta, Spionidae)." (2009). Worm (Spionidae) 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Wray, Susan, Ronald H. Baisden, and Michael L. Woodruff. "Neurochemical anatomy of fetal hippocampus transplanted into large lesion cavities made in the adult rat brain." Experimental neurology 111.1 (1991): 36-48. Rat 4 1701734
20077 VIP (Vasoactive Intestinal Peptide) Antibody Beal, M. Flint, et al. "Neurochemical characterization of excitotoxin lesions in the cerebral cortex." The Journal of neuroscience 11.1 (1991): 147-158. Rat IHC 98 1670782
20077 VIP (Vasoactive Intestinal Peptide) Antibody Shochina, M., et al. "Neurochemical coding in the myenteric plexus of the upper gastrointestinal tract of hibernating hamsters." International journal of developmental neuroscience 15.3 (1997): 353-362. Hamster 7 9253659
20077 VIP (Vasoactive Intestinal Peptide) Antibody Belai, A., et al. "Neurochemical coding in the small intestine of patients with Crohn's disease." Gut 40.6 (1997): 767-774. Human IHC Crohn's 134 9245931
20077 VIP (Vasoactive Intestinal Peptide) Antibody Uyttebroek, Leen, et al. "Neurochemical coding of enteric neurons in adult and embryonic zebrafish (Danio rerio)." Journal of Comparative Neurology 518.21 (2010): 4419-4438. Fish IF 18 20853514
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sako, T., et al. "Neuroendocrine carcinoma in the nasal cavity of ten dogs." Journal of comparative pathology 133.2 (2005): 155-163. Dog IHC 17 16045921
20077 VIP (Vasoactive Intestinal Peptide) Antibody Maney, Donna L., Kelly L. Erwin, and Christopher T. Goode. "Neuroendocrine correlates of behavioral polymorphism in white-throated sparrows." Hormones and behavior 48.2 (2005): 196-206. Sparrow IHC 41 15878570
20077 VIP (Vasoactive Intestinal Peptide) Antibody Antle, Michael C., Joseph LeSauter, and Rae Silver. "Neurogenesis and ontogeny of specific cell phenotypes within the hamster suprachiasmatic nucleus." Developmental brain research 157.1 (2005): 8-18. Hamster ICC 16 15939080
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hoyle, Charles HV, et al. "Neuromuscular transmission and innervation in the urinary bladder of the insectivoreSuncus murinus." Journal of the autonomic nervous system 69.1 (1998): 31-38. Suncus Murinus (Shrew) 15 9672121
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Cell Biol. 2014 Feb 3;204(3):331-42. doi: 10.1083/jcb.201310136. Epub 2014 Jan 27.Neuronal cell type-specific alternative splicing is regulated by the KH domain protein SLM1.Iijima T1, Iijima Y, Witte H, Scheiffele P. IHC 1 24469635
20077 VIP (Vasoactive Intestinal Peptide) Antibody Heym, Ch, et al. "Neuronal pathways in the guinea-pig lumbar sympathetic ganglia as revealed by immunohistochemistry." Histochemistry 93.5 (1990): 547-557. Guinea Pig 30 2185201
20077 VIP (Vasoactive Intestinal Peptide) Antibody Aioun, J., et al. "Neurons containing gastrin-releasing peptide and vasoactive intestinal polypeptide are involved in the reception of the photic signal in the suprachiasmatic nucleus of the Syrian hamster: an immunocytochemical ultrastructural study." Cell and tissue research 291.2 (1998): 239-253. Hamster 39 9426311
20077 VIP (Vasoactive Intestinal Peptide) Antibody Peytevin, J., J. Aioun, and I. Chambille. "Neurons that express the AMPA receptor GluR2/3 subunits in suprachiasmatic nuclei of Syrian hamsters colocalize either vasoactive intestinal peptide, peptide histidine isoleucine or gastrin-releasing peptide." Cell and tissue research 300.2 (2000): 345-359. Hamster 11 10867829
20077 VIP (Vasoactive Intestinal Peptide) Antibody Block, Christine H., and Gloria E. Hoffman. "Neuropeptide and monoamine components of the parabrachial pontine complex." Peptides 8.2 (1987): 267-283. 54 2884646
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kummer, Wolfgang, and Christine Heym. "Neuropeptide distribution in the cervico-thoracic paravertebral ganglia of the cat with particular reference to calcitonin gene-related peptide immunoreactivity." Cell and tissue research 252.2 (1988): 463-471. Cat 49 2898295
20077 VIP (Vasoactive Intestinal Peptide) Antibody Mulderry, P. K. "Neuropeptide expression by newborn and adult rat sensory neurons in culture: effects of nerve growth factor and other neurotrophic factors." Neuroscience 59.3 (1994): 673-688. Rat ICC 99 7516508
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cummings, Sharon L. "Neuropeptide Y, somatostatin, and cholecystokinin of the anterior piriform cortex." Cell and tissue research 289.1 (1997): 39-51. 10 9182599
20077 VIP (Vasoactive Intestinal Peptide) Antibody Grimes, Patricia A., et al. "Neuropeptide Y-like immunoreactivity localizes to preganglionic axon terminals in the rhesus monkey ciliary ganglion." Investigative ophthalmology & visual science 39.2 (1998): 227-232. Monkey IHC 5 9477979
20077 VIP (Vasoactive Intestinal Peptide) Antibody Matsuda, H. I. D. E. K. I., et al. "Neuropeptide-containing nerve fibres in the human parotid gland: a semiquantitative analysis using an antibody against protein gene product 9.5." The Histochemical Journal 29.7 (1997): 539-544. Human 8 9279556
20077 VIP (Vasoactive Intestinal Peptide) Antibody Quartu, M., J. M. Polak, and M. Del Fiacco. "Neuropeptides in the human celiac/superior mesenteric ganglionic complex: an immunohistochemical study." Journal of chemical neuroanatomy 6.2 (1993): 79-99. Human IF 5 8476542
20077 VIP (Vasoactive Intestinal Peptide) Antibody Brenneman, Douglas E., Lee E. Eiden, and Ruth E. Siegel. "Neurotrophic action of VIP on spinal cord cultures." Peptides 6 (1985): 35-39. IHC 105 4080617
20077 VIP (Vasoactive Intestinal Peptide) Antibody Helke, Cinda J., and Dominik Verdier-Pinard. "Neurotrophins alter the numbers of neurotransmitter-ir mature vagal/glossopharyngeal visceral afferent neurons in vitro." Brain research 884.1 (2000): 206-212. 12 11082504
20077 VIP (Vasoactive Intestinal Peptide) Antibody Liu, Hai-Ping, Samuel-Sam-Wah Tay, and Seng-Kee Leong. "Nitrergic neurons in the pancreas of newborn guinea pig: their distribution and colocalization with various neuropeptides and dopamine-< i> ?-hydroxylase." Journal of the autonomic nervous system 61.3 (1996): 248-256. Guinea Pig 19 8988482
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ishine, Takaaki, et al. "Nitric oxide is the predominant mediator for neurogenic vasodilation in porcine pial veins." Journal of Pharmacology and Experimental Therapeutics 289.1 (1999): 398-404. Pig IHC 9 10087030
20077 VIP (Vasoactive Intestinal Peptide) Antibody Histochem Cell Biol. 1995 Jul;104(1):21-8. Nitric oxide synthase in guinea pig sympathetic ganglia: correlation with tyrosine hydroxylase and neuropeptides. Höhler B1, Olry R, Mayer B, Kummer W. Guinea Pig 26 7584556
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kummer, Wolfgang, et al. "Nitric oxide synthase in VIP-containing vasodilator nerve fibres in the Guineapig." Neuroreport 3.7 (1992): 653. Guinea Pig IHC 136 1384769
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vanhatalo, Sampsa, et al. "No colocalization of immunoreactivities for VIP and neuronal NOS, and a differential relation to cGMP-immunoreactivity in bovine penile smooth muscle." Journal of chemical neuroanatomy 19.2 (2000): 81-91. 8 10936744
20077 VIP (Vasoactive Intestinal Peptide) Antibody Liu, Tong-hua, et al. "Nonfunctioning pancreatic endocrine tumors: an immunohistochemical and electron microscopic analysis of 26 cases." Pathology-Research and Practice 188.1 (1992): 191-198. 26 1317556
20077 VIP (Vasoactive Intestinal Peptide) Antibody Anderson, Rebecca L., Ian L. Gibbins, and Judy L. Morris. "Non-noradrenergic sympathetic neurons project to extramuscular feed arteries and proximal intramuscular arteries of skeletal muscles in guinea-pig hindlimbs." Journal of the autonomic nervous system 61.1 (1996): 51-60. Guinea Pig 26 8912254
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawaguchi, Yasuo, and Tomomi Shindou. "Noradrenergic excitation and inhibition of GABAergic cell types in rat frontal cortex." The Journal of neuroscience 18.17 (1998): 6963-6976. Rat IHC 149 9712665
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tafari, A. Tsahai, Steven A. Thomas, and Richard D. Palmiter. "Norepinephrine facilitates the development of the murine sweat response but is not essential." The Journal of neuroscience 17.11 (1997): 4275-4281. Mouse IHC 15 9151744
20077 VIP (Vasoactive Intestinal Peptide) Antibody Berk, Mitchell L., Stacy E. Smith, and Harvey J. Karten. "Nucleus of the solitary tract and dorsal motor nucleus of the vagus nerve of the pigeon: Localization of peptide and 5?hydroxytryptamine immunoreactive fibers." Journal of Comparative Neurology 338.4 (1993): 521-548. Pigeon 29 8132859
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gomariz, Rosa P., ANGEL HERNANZ, and JAVIER LECETA. "Occurrence of Vasoactive Intestinal Peptide (VIP) in Lymphoid Organs from Rat and Mousea." Annals of the New York Academy of Sciences 650.1 (1992): 13-18. Mouse, Rat 32 1605471
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ichikawa, H., et al. "Ontogeny of cholinergic ganglionic cells which take up L-3, 4-dihydroxyphenylalanine and contain vasoactive intestinal polypeptide in the mouse tongue." Cells Tissues Organs 140.2 (1991): 135-138. Mouse IHC 2 1867054
20077 VIP (Vasoactive Intestinal Peptide) Antibody Engeland, W. C., C. Wotus, and J. C. Rose. "Ontogeny of innervation of rat and ovine fetal adrenals." Endocrine research 24.3-4 (1998): 889-898. Rat, Ovine (Sheep) IF 13 9888594
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, Tatsumi. "Ontogeny of substance P-, CGRP-, and VIP-containing nerve fibers in the amphibian carotid labyrinth of the bullfrog, Rana catesbeiana." Cell and tissue research 269.1 (1992): 79-85. Bullfrog IHC 19 1384974
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, Tatsumi, et al. "Ontogeny of the peptidergic fibers in the male mouse submandibular gland." Developmental brain research 95.1 (1996): 125-130. Mouse IHC 5 8873984
20077 VIP (Vasoactive Intestinal Peptide) Antibody Aguilar-Roblero R1, Salazar-Juarez A, Rojas-Castañeda J, Escobar C, Cintra L, Am J Physiol. 1997 Oct;273(4 Pt 2):R1321-31."Organization of circadian rhythmicity and suprachiasmatic nuclei in malnourished rats" Rat IHC 36 9362295
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hara, Hideaki, Geoffrey S. Hamill, and David M. Jacobowitz. "Origin of cholinergic nerves to the rat major cerebral arteries: coexistence with vasoactive intestinal polypeptide." Brain research bulletin 14.2 (1985): 179-188. Rat 180 3888351
20077 VIP (Vasoactive Intestinal Peptide) Antibody Moga, Margaret M., and Taihung Duong. "P75 neurotrophin receptor immunoreactivity in the aged human hypothalamus." Neuroscience letters 231.1 (1997): 9-12. Human 6 9280155
20077 VIP (Vasoactive Intestinal Peptide) Antibody Raphael, Simon J., et al. "Pancreatic xanthomatous neuropathy associated with hyperlipidemia: A cause of abdominal pain mimicking chronic pancreatitis." Human pathology 24.9 (1993): 1023-1025. 2 8253457
20077 VIP (Vasoactive Intestinal Peptide) Antibody Grignon, David J., et al. "Paraganglioma of the urinary bladder: immunohistochemical, ultrastructural, and DNA flow cytometric studies." Human pathology 22.11 (1991): 1162-1169. DNA 48 1743702
20077 VIP (Vasoactive Intestinal Peptide) Antibody Warren, William H., et al. "Paragangliomas of the head and neck: ultrastructural and immunohistochemical analysis." Ultrastructural pathology 8.4 (1985): 333-343. 39 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Peptides. 2000 Feb;21(2):271-81. Parallel increase in substance P and VIP in rat duodenum in response to irradiation. Höckerfelt U1, Franzén L, Kjörell U, Forsgren S. Rat 16 10764956
20077 VIP (Vasoactive Intestinal Peptide) Antibody Albrecht, Phillip J., et al. "Pathologic alterations of cutaneous innervation and vasculature in affected limbs from patients with complex regional pain syndrome." Pain 120.3 (2006): 244-266. IHC 162 16427199
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hara, H., and B. Weir. "Pathway of nerves with vasoactive intestinal polypeptide-like immunoreactivity to the major cerebral arteries of the rat." Cell and tissue research 251.2 (1988): 275-280. Rat IHC 12 3345543
20077 VIP (Vasoactive Intestinal Peptide) Antibody Veening, J. G., et al. "Patterns of c-fos expression induced by fluvoxamine are different after acute vs. chronic oral administration." European neuropsychopharmacology 8.3 (1998): 213-226. 28 9716316
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keast, J. R. "Patterns of co-existence of peptides and differences of nerve fibre types associated with noradrenergic and non-noradrenergic (putative cholinergic) neurons in the major pelvic ganglion of the male rat." Cell and tissue research 266.2 (1991): 405-415. Rat 75 1722433
20077 VIP (Vasoactive Intestinal Peptide) Antibody Marongiu, L., et al. "Peptidergic (VIP) nerves in normal human pancreas and in pancreatitis, an immunohistochemical study." (1993). Human IHC 5 8443423
20077 VIP (Vasoactive Intestinal Peptide) Antibody Belfry, C. Susan, and F. Brian M. Cowan. "Peptidergic and adrenergic innervation of the lachrymal gland in the euryhaline turtle, Malaclemys terrapin." Journal of Experimental Zoology 273.5 (1995): 363-375. Turtle 8 8576694
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ball, Gregory F., Philippe Absil, and Jacques Balthazart. "Peptidergic delineations of nucleus interface reveal a sex difference in volume." Neuroreport 6.7 (1995): 957-960. 15 7632898
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kusakabe, T., et al. "Peptidergic innervation in the rat carotid body after 2, 4, and 8 weeks of hypocapnic hypoxic exposure." (2003). Rat IHC 15 12647791
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rechardt, L., et al. "Peptidergic innervation of human atrial myocardium: an electron microscopical and immunocytochemical study." Journal of the autonomic nervous system 17.1 (1986): 21-32. Human 34 2430006
20077 VIP (Vasoactive Intestinal Peptide) Antibody Guarna, M., et al. "Peptidergic innervation of mesenteric lymphatics in guinea pigs: an immunocytochemical and pharmacological study." Lymphology 24.4 (1991): 161-167. Guinea Pig 24 1724275
20077 VIP (Vasoactive Intestinal Peptide) Antibody Chung, Christine W., Margarete Tigges, and Richard A. Stone. "Peptidergic innervation of the primate meibomian gland." Investigative ophthalmology & visual science 37.1 (1996): 238-245. Monkey IHC 56 8550329
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ye, X. D., A. M. Laties, and R. A. Stone. "Peptidergic innervation of the retinal vasculature and optic nerve head." Investigative ophthalmology & visual science 31.9 (1990): 1731-1737. Monkey 105 1698744
20077 VIP (Vasoactive Intestinal Peptide) Antibody McNeill, D. L., and H. W. Burden. "Peripheral pathways for neuropeptide Y-and cholecystokinin-8-immunoreactive nerves innervating the rat ovary." Neuroscience letters 80.1 (1987): 27-32. Rat ICC 9 3658228
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawamura, Koji, Koichi Ando, and Shigeo Takebayashi. "Perivascular innervation of the mesenteric artery in spontaneously hypertensive rats." Hypertension 14.6 (1989): 660-665. Rat 27 2479602
20077 VIP (Vasoactive Intestinal Peptide) Antibody Baker FC1, Angara C, Szymusiak R, McGinty D., Am J Physiol Regul Integr Comp Physiol. 2005 Sep;289(3):R827-38. Epub 2005 Apr 28."Persistence of sleep-temperature coupling after suprachiasmatic nuclei lesions in rats" Rat IHC 15860650
20077 VIP (Vasoactive Intestinal Peptide) Antibody Canning, Brendan J., Axel Fischer, and Bradley J. Undem. "Pharmacological analysis of the tachykinin receptors that mediate activation of nonadrenergic, noncholinergic relaxant nerves that innervate guinea pig trachealis." Journal of Pharmacology and Experimental Therapeutics 284.1 (1998): 370-377. Guinea Pig IHC 33 9435200
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kuhlman, Sandra J., et al. "Phase resetting light pulses induce Per1 and persistent spike activity in a subpopulation of biological clock neurons." The Journal of neuroscience 23.4 (2003): 1441-1450. Mouse IF 83 12598633
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hyatt-Sachs, H., et al. "Phenotypic plasticity in adult sympathetic ganglia in vivo: effects of deafferentation and axotomy on the expression of vasoactive intestinal peptide." The Journal of neuroscience 13.4 (1993): 1642-1653. 107 8463841
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rainnie, Donald Gordon, et al. "Physiological and morphological characterization of parvalbumin?containing interneurons of the rat basolateral amygdala." Journal of Comparative Neurology 498.1 (2006): 142-161. Rat IF 58 16856165
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawaguchi, Yasuo, and Yoshiyuki Kubota. "Physiological and morphological identification of somatostatin-or vasoactive intestinal polypeptide-containing cells among GABAergic cell subtypes in rat frontal cortex." The Journal of neuroscience 16.8 (1996): 2701-2715. Rat 241 8786446
20077 VIP (Vasoactive Intestinal Peptide) Antibody Miyoshi, Goichi, et al. "Physiologically distinct temporal cohorts of cortical interneurons arise from telencephalic Olig2-expressing precursors." The Journal of neuroscience 27.29 (2007): 7786-7798. Mouse IHC 160 17634372
20077 VIP (Vasoactive Intestinal Peptide) Antibody Peyronnet, J., et al. "Plasticity in the phenotypic expression of catecholamines and vasoactive intestinal peptide in adult rat superior cervical and stellate ganglia after long-term hypoxiain vivo." Neuroscience 91.3 (1999): 1183-1194. Rat IHC Hypoxia 17 10391493
20077 VIP (Vasoactive Intestinal Peptide) Antibody Klimaschewski, Lars, et al. "Plasticity of postganglionic sympathetic neurons in the rat superior cervical ganglion after axotomy." Microscopy research and technique 29.2 (1994): 120-130. Rat 38 7529068
20077 VIP (Vasoactive Intestinal Peptide) Antibody Uemura, Yoshihiko, et al. "Possible origins of cerebrovascular nerve fibers showing vasoactive intestinal polypeptide-like immunoreactivity: an immunohistochemical study in the dog." Brain research 448.1 (1988): 98-105. Dog 19 3292011
20077 VIP (Vasoactive Intestinal Peptide) Antibody Brock, J. A., D. J. Handelsman, and J. R. Keast. "Postnatal androgen deprivation dissociates the development of smooth muscle innervation from functional neurotransmission in mouse vas deferens." The Journal of physiology 581.2 (2007): 665-678. Mouse IHC 8 17379637
20077 VIP (Vasoactive Intestinal Peptide) Antibody Schultea, T. D., W. L. Dees, and S. R. Ojeda. "Postnatal development of sympathetic and sensory innervation of the rhesus monkey ovary." Biology of reproduction 47.5 (1992): 760-767. Monkey 21 1282372
20077 VIP (Vasoactive Intestinal Peptide) Antibody Muller, Jay F., Franco Mascagni, and Alexander J. McDonald. "Postsynaptic targets of somatostatin?containing interneurons in the rat basolateral amygdala." Journal of Comparative Neurology 500.3 (2007): 513-529. Rat IHC 59 17120289
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ichikawa, Hiroyuki, Alexander Rabchevsky, and Cinda J. Helke. "Presence and coexistence of putative neurotransmitters in carotid sinus baro-and chemoreceptor afferent neurons." Brain research 611.1 (1993): 67-74. Rat IF 47 8100177
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jordan, F. L., G. K. Rieke, and W. E. Thomas. "Presence and development of ependymal cells in primary tissue cultures derived from embryonic rat cerebral cortex." Developmental Brain Research 35.1 (1987): 97-110. Rat IHC 17 1638739
20077 VIP (Vasoactive Intestinal Peptide) Antibody Dvorackova, Jana, et al. "Primary neuroendocrine carcinoma of the kidney." Biomedical Papers of the Medical Faculty of Palacky University in Olomouc 157.3 (2013). Human IHC 0 23073523
20077 VIP (Vasoactive Intestinal Peptide) Antibody Riedel, A., et al. "Principles of rat subcortical forebrain organization: a study using histological techniques and multiple fluorescence labeling." Journal of chemical neuroanatomy 23.2 (2002): 75-104. Rat IF 53 11841914
20077 VIP (Vasoactive Intestinal Peptide) Antibody Masuko, Sadahiko, and Tanemichi Chiba. "Projection pathways, co-existence of peptides and synaptic organization of nerve fibers in the inferior mesenteric ganglion of the guinea-pig." Cell and tissue research 253.3 (1988): 507-516. Guinea Pig 34 2460240
20077 VIP (Vasoactive Intestinal Peptide) Antibody Steele, Penelope A., Ian L. Gibbins, and Judy L. Morris. "Projections of intrinsic cardiac neurons to different targets in the guinea-pig heart." Journal of the autonomic nervous system 56.3 (1996): 191-200. Guinea Pig IHC 23 8847443
20077 VIP (Vasoactive Intestinal Peptide) Antibody Grasby, D. J., I. L. Gibbins, and J. L. Morris. "Projections of sympathetic non-noradrenergic neurons to skeletal muscle arteries in guinea-pig limbs vary with the metabolic character of muscles." Journal of vascular research 34.5 (1997): 351-364. Guinea Pig metabolic 16 9349729
20077 VIP (Vasoactive Intestinal Peptide) Antibody DOUSA, THOMAS P., GEORGE S. DOUGHERTY, and ANDREW P. EVAN. "Proximal tubule characteristics of cultured human renal cortex epithelium." J Lab Clin Med (1989). Human IHC 57 2538526
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cogliati, Tiziana, et al. "Pubertal impairment in Nhlh2 null mice is associated with hypothalamic and pituitary deficiencies." Molecular Endocrinology 21.12 (2007): 3013-3027. Mouse 11 17717072
20077 VIP (Vasoactive Intestinal Peptide) Antibody Nolano, Maria, et al. "Quantification of myelinated endings and mechanoreceptors in human digital skin." Annals of neurology 54.2 (2003): 197-205. Human IHC 105 12891672
20077 VIP (Vasoactive Intestinal Peptide) Antibody Carrillo, ALBERT0 J., and CAROL J. Phelps. "Quantification of vasoactive intestinal peptide immunoreactivity in the anterior pituitary glands of intact male and female, ovariectomized, and estradiol benzoate-treated rats." Endocrinology 131.2 (1992): 964-969. Rat 19 1639033
20077 VIP (Vasoactive Intestinal Peptide) Antibody Uematsu, Masakazu, et al. "Quantitative chemical composition of cortical GABAergic neurons revealed in transgenic venus-expressing rats." Cerebral Cortex 18.2 (2008): 315-330. Rat, Mouse IHC 77 17517679
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Histochem Cytochem. 1999 Nov;47(11):1405-16. Quantitative comparison of growth-associated protein GAP-43, neuron-specific enolase, and protein gene product 9.5 as neuronal markers in mature human intestine.Vento P1, Soinila S. Human IHC 22 10544214
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Histochem Cytochem. 2001 Jun;49(6):749-58. Quantitative comparison of growth-associated protein-43 and substance P in ulcerative colitis.Vento P1, Kiviluoto T, Keränen U, Järvinen HJ, Kivilaakso E, Soinila S. Human IHC ulcerative colitis 33 11373321
20077 VIP (Vasoactive Intestinal Peptide) Antibody Histochemistry. 1988;90(2):139-44. Quantitative immunohistochemical analysis of VIP-neurons in the rat visual cortex. Hajós F1, Zilles K. Rat 11 3230046
20077 VIP (Vasoactive Intestinal Peptide) Antibody Henrich, Michael, et al. "Quantitative immunohistochemical investigation of the intrinsic vasodilator innervation of the guinea pig lingual artery." Autonomic Neuroscience 103.1 (2003): 72-82. Guinea Pig 8 12531400
20077 VIP (Vasoactive Intestinal Peptide) Antibody Straessle, Andrea, et al. "Rapid and long-term alterations of hippocampal GABAB receptors in a mouse model of temporal lobe epilepsy." European Journal of Neuroscience 18.8 (2003): 2213-2226. Mouse 46 14622182
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Neuroendocrinol. 2000 Sep;12(9):881-93. Rat adrenal transplants are reinnervated: an invalid model of denervated adrenal cortical tissue.Ulrich-Lai YM1, Engeland WC. Rat 17 10971813
20077 VIP (Vasoactive Intestinal Peptide) Antibody Houdeau, E., M-J. Prud'Homme, and J-P. Rousseau. "Regional difference in the distribution of vasoactive intestinal polypeptide-immunoreactive nerve fibres along the uterus and between myometrial muscle layers in the rat." The Histochemical Journal 30.7 (1998): 525-529. 6 10192536
20077 VIP (Vasoactive Intestinal Peptide) Antibody Edyvane, Katherine A., et al. "Regional differences in the innervation of the human ureterovesical junction by tyrosine hydroxylase-, vasoactive intestinal peptide-and neuropeptide Y-like immunoreactive nerves." The Journal of urology 154.1 (1995): 262-268. Human 16 7776442
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tsuruda, Lori M., et al. "Region-specific central nervous system expression and axotomy-induced regulation in sympathetic neurons of a VIP-?-galactosidase fusion gene in transgenic mice." Molecular brain research 42.2 (1996): 181-192. Mouse 8 9013773
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keast, J. R. "Remodelling of connections in pelvic ganglia after hypogastric nerve crush." Neuroscience 126.2 (2004): 405-414. 11 15207358
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rachdi, Latif, Jean-Claude Marie, and Raphael Scharfmann. "Role for VPAC2 receptor-mediated signals in pancreas development." Diabetes 52.1 (2003): 85-92. Rat 12 12502497
20077 VIP (Vasoactive Intestinal Peptide) Antibody Saito, A., et al. "Role of calcitonin gene-related peptide as cardiotonic neurotransmitter in guinea pig left atria." Journal of Pharmacology and Experimental Therapeutics 243.2 (1987): 731-736. Guinea Pig 63 2890760
20077 VIP (Vasoactive Intestinal Peptide) Antibody Close, Jennie, et al. "Satb1 is an activity-modulated transcription factor required for the terminal differentiation and connectivity of medial ganglionic eminence-derived cortical interneurons." The Journal of Neuroscience 32.49 (2012): 17690-17705. Mouse IHC Transcription Factor 13 23223290
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawaguchi, Yasuo. "Selective cholinergic modulation of cortical GABAergic cell subtypes." Journal of neurophysiology 78.3 (1997): 1743-1747. Rat IHC 134 9310461
20077 VIP (Vasoactive Intestinal Peptide) Antibody Penix, LaRoy P., and Claude G. Wasterlain. "Selective protection of neuropeptide containing dentate hilar interneurons by non-NMDA receptor blockade in an animal model of status epilepticus." Brain research 644.1 (1994): 19-24. IHC 29 8032945
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kummer, W. "Sensory ganglia as a target of autonomic and sensory nerve fibres in the guinea-pig." Neuroscience 59.3 (1994): 739-754. Guinea Pig 22 7516509
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vilimas, Patricia I., et al. "Sensory innervation of the external genital tract of female guinea pigs and mice." The journal of sexual medicine 8.7 (2011): 1985-1995. Guinea Pig, Mouse IHC 5 21477025
20077 VIP (Vasoactive Intestinal Peptide) Antibody Suseki, Kaoru, et al. "Sensory nerve fibres from lumbar intervertebral discs pass through rami communicantes A POSSIBLE PATHWAY FOR DISCOGENIC LOW BACK PAIN." Journal of Bone & Joint Surgery, British Volume 80.4 (1998): 737-742. Rat IHC 94 9699846
20077 VIP (Vasoactive Intestinal Peptide) Antibody Schwerdtfeger, Priv-Doz Dr Walter K. "Septal afferents to the area dentata terminate on vasoactive intestinal polypeptide (VIP)-like immunoreactive, non-pyramidal neurons." Cell and tissue research 244.1 (1986): 235-238. Rat 12 3516401
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vucurovic, Ksenija, et al. "Serotonin 3A receptor subtype as an early and protracted marker of cortical interneuron subpopulations." Cerebral Cortex 20.10 (2010): 2333-2347. Mouse IHC 48 20083553
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vittoria, A., et al. "Serotonin-, somatostatin-and chromogranin A-containing cells of the urethro-prostatic complex in the sheep. An immunocytochemical and immunofluorescent study." Journal of anatomy 171 (1990): 169. Ram / Sheep IF 26 1981998
20077 VIP (Vasoactive Intestinal Peptide) Antibody Daughaday, WILLIAM H., M. I. L. A. N. Kapadia, and I. Mariz. "Serum somatomedin binding proteins: physiologic significance and interference in radioligand assay." J Lab Clin Med 109.3 (1987): 355-363. 163 2434590
20077 VIP (Vasoactive Intestinal Peptide) Antibody Abizaid, Alfonso, et al. "Sex differences in adult suprachiasmatic nucleus neurons emerging late prenatally in rats." European Journal of Neuroscience 19.9 (2004): 2488-2496. Rat IHC 21 15128402
20077 VIP (Vasoactive Intestinal Peptide) Antibody Russo, D., et al. "Signal amplification by combining two advanced immunohistochemical techniques." European Journal of Histochemistry 47.4 (2009): 379-384. 5 14706935
20077 VIP (Vasoactive Intestinal Peptide) Antibody Papotti, M., D. Galliano, and G. Monga. "Signet-ring cell carcinoid of the gallbladder." Histopathology 17.3 (1990): 255-259. 16 2173677
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kummer, W. "Simultaneous immunohistochemical demonstration of vasoactive intestinal polypeptide and its receptor in human colon." The Histochemical Journal 22.5 (1990): 249-256. Human 9 1723721
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jansen, Heiko T., et al. "Single-and double-label immunocytochemical study of the ovine suprachiasmatic nucleus (SCN): GABAergic and peptidergic relationships." Brain research bulletin 34.5 (1994): 499-506. Sheep 7 8082043
20077 VIP (Vasoactive Intestinal Peptide) Antibody Donadio, Vincenzo, et al. "Skin sympathetic adrenergic innervation: an immunofluorescence confocal study." Annals of neurology 59.2 (2006): 376-381. Human 37 16437571
20077 VIP (Vasoactive Intestinal Peptide) Antibody Donadio, Vincenzo, et al. "Skin sympathetic fiber ?-synuclein deposits A potential biomarker for pure autonomic failure." Neurology 80.8 (2013): 725-732. IHC 2 23390175
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tran, Phu V., Michael K. Georgieff, and William C. Engeland. "Sodium depletion increases sympathetic neurite outgrowth and expression of a novel TMEM35 gene-derived protein (TUF1) in the rat adrenal zona glomerulosa." Endocrinology 151.10 (2010): 4852-4860. Rat 3 20685870
20077 VIP (Vasoactive Intestinal Peptide) Antibody Elliott, W. M., and J. H. Youson. "Somatostatin concentrations in the pancreatic-intestinal tissues of the sea lamprey,< i> Petromyzon marinus L., at various periods of its life cycle." Comparative Biochemistry and Physiology Part A: Physiology 99.3 (1991): 357-360. Sea Lamprey 11 1678333
20077 VIP (Vasoactive Intestinal Peptide) Antibody Fiacco, Marina Del, and Marina Quartu. "Somatostatin, galanin and peptide histidine isoleucine in the newborn and adult human trigeminal ganglion and spinal nucleus: immunohistochemistry, neuronal morphometry and colocalization with substance P." Journal of chemical neuroanatomy 7.3 (1994): 171-184. 24 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kulmala, Henrik K. "Some enkephalin-or VIP-immunoreactive hippocampal pyramidal cells contain neurofibrillary tangles in the brains of aged humans and persons with Alzheimer Human alzheimer 12 2410823
20077 VIP (Vasoactive Intestinal Peptide) Antibody An, Sungwon, et al. "Spatiotemporal distribution of vasoactive intestinal polypeptide receptor 2 in mouse suprachiasmatic nucleus." Journal of Comparative Neurology 520.12 (2012): 2730-2741. Mouse IF 4 22684939
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Neurosci. 1999 Apr 15;19(8):3073-93. Spatiotemporal patterns of activity in an intact mammalian network with single-cell resolution: optical studies of nicotinic activity in an enteric plexus. Obaid AL1, Koyano T, Lindstrom J, Sakai T, Salzberg BM. Guinea Pig IHC 75 10191324
20077 VIP (Vasoactive Intestinal Peptide) Antibody PRUSS, REBECCA M., et al. "Specific Regulation of Vasoactive Intestinal Polypeptide Biosynthesis by Phorbol Ester in Bovine Chromaffin Cells*." Endocrinology 117.3 (1985): 1020-1026. 46 3839453
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kepper, Mark E., and Janet R. Keast. "Specific targeting of ganglion cell sprouts provides an additional mechanism for restoring peripheral motor circuits in pelvic ganglia after spinal nerve damage." The Journal of neuroscience 18.19 (1998): 7987-7995. Rat IHC 19 9742165
20077 VIP (Vasoactive Intestinal Peptide) Antibody Coulombe, James N., and Rae Nishi. "Stimulation of somatostatin expression in developing ciliary ganglion neurons by cells of the choroid layer." The Journal of neuroscience 11.2 (1991): 553-562. Chicken ICC 50 1671409
20077 VIP (Vasoactive Intestinal Peptide) Antibody Regalia, Jen, Fang Cai, and Cinda Helke. "Streptozotocin-induced diabetes and the neurochemistry of vagal afferent neurons." Brain research 938.1 (2002): 7-14. ICC diabete 20 12031529
20077 VIP (Vasoactive Intestinal Peptide) Antibody Whitnall, M. H. "Subpopulations of corticotropin-releasing hormone neurosecretory cells distinguished by presence or absence of vasopressin: confirmation with multiple corticotropin-releasing hormone antisera." Neuroscience 36.1 (1990): 201-205. 11 2215918
20077 VIP (Vasoactive Intestinal Peptide) Antibody TANAKA, YASUMASA, et al. "SUBSTANCE P AND CALCITONINE GENE-RELATED PEPTIDE IMMUNOREACTIVE NERVE FIBERS IN THE LARYNX OF CATS." Recent Advances in Bronchoesophagology: Proceedings of the 6th World Congress of Bronchoesophagology, Tokyo, 15-18 October 1989. Excerpta Medica, 1990. Cat 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sloviter, Robert S., et al. "Substance P receptor expression by inhibitory interneurons of the rat hippocampus: enhanced detection using improved immunocytochemical methods for the preservation and colocalization of GABA and other neuronal markers." Journal of Comparative Neurology 430.3 (2001): 283-305. Rat IHC 80 11169468
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ogawa-Meguro, R., K. Itoh, and N. Mizuno. "Substance P-, vasoactive intestinal polypeptide-, and cholecystokinin-like immunoreactive fiber projections from the superior colliculus to the dorsal lateral geniculate nucleus in the rat." Experimental brain research 89.1 (1992): 59-66. Rat 19 1376278
20077 VIP (Vasoactive Intestinal Peptide) Antibody Chouchkov, C., and M. Davidoff. "Substance P-and Somatostatin-Like Immunoreactivity in Avian Encapsulated Mechanoreceptors." Mechanoreceptors. Springer US, 1988. 295-300. IHC 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vilches, Jorge J., et al. "Sudomotor function and sweat gland innervation in galanin knockout mice." Neuropeptides 46.4 (2012): 151-155. Mouse 2 22698811
20077 VIP (Vasoactive Intestinal Peptide) Antibody Goel, N., T. M. Lee, and L. Smale. "Suprachiasmatic nucleus and intergeniculate leaflet in the diurnal rodentOctodon degus: retinal projections and immunocytochemical characterization." Neuroscience 92.4 (1999): 1491-1509. 59 10426502
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kudo, M., M. Yamamoto, and Y. Nakamura. "Suprachiasmatic nucleus and retinohypothalamic projections in moles." Brain, behavior and evolution 38.6 (1991): 332-338. Mole 19 1764636
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sujino, Mitsugu, et al. "Suprachiasmatic nucleus grafts restore circadian behavioral rhythms of genetically arrhythmic mice." Current biology 13.8 (2003): 664-668. Mouse IHC 75 12699623
20077 VIP (Vasoactive Intestinal Peptide) Antibody Moore, Robert Y., Joan C. Speh, and Rehana K. Leak. "Suprachiasmatic nucleus organization." Cell and tissue research 309.1 (2002): 89-98. Rat IHC 354 12111539
20077 VIP (Vasoactive Intestinal Peptide) Antibody Muller, Jay F., Franco Mascagni, and Alexander J. Mcdonald. "Synaptic connections of distinct interneuronal subpopulations in the rat basolateral amygdalar nucleus." Journal of Comparative Neurology 456.3 (2003): 217-236. Rat IF 65 12528187
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gibbins, Ian L., et al. "Synaptic density, convergence, and dendritic complexity of prevertebral sympathetic neurons." Journal of Comparative Neurology 455.3 (2003): 285-298. Guinea Pig IHC 25 12483682
20077 VIP (Vasoactive Intestinal Peptide) Antibody Mulderry, P. K. "Synergistic regulation of vasoactive intestinal polypeptide expression by cyclic AMP and calcium in newborn but not adult rat sensory neurons in culture." Neuroscience 53.1 (1993): 229-238. Rat 8 7682299
20077 VIP (Vasoactive Intestinal Peptide) Antibody Klimaschewski, L., I. Grohmann, and C. Heym. "Target-dependent plasticity of galanin and vasoactive intestinal peptide in the rat superior cervical ganglion after nerve lesion and re-innervation." Neuroscience 72.1 (1996): 265-272. Rat IHC 24 8730723
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kriegsfeld, Lance J., Joseph LeSauter, and Rae Silver. "Targeted microlesions reveal novel organization of the hamster suprachiasmatic nucleus." The Journal of neuroscience 24.10 (2004): 2449-2457. Hamster 56 15014120
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kriegsfeld, Lance J., et al. "Targeted mutation of the calbindin D28K gene disrupts circadian rhythmicity and entrainment." European Journal of Neuroscience 27.11 (2008): 2907-2921. Mouse 20 18588531
20077 VIP (Vasoactive Intestinal Peptide) Antibody Meusburger, S. M., and J. R. Keast. "Testosterone and nerve growth factor have distinct but interacting effects on structure and neurotransmitter expression of adult pelvic ganglion cellsin vitro." Neuroscience 108.2 (2001): 331-340. IHC 54 12136843
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keast, J. R., and R. J. Saunders. "Testosterone has potent, selective effects on the morphology of pelvic autonomic neurons which control the bladder, lower bowel and internal reproductive organs of the male rat." Neuroscience 85.2 (1998): 543-556. Rat 77 9622251
20077 VIP (Vasoactive Intestinal Peptide) Antibody Azanza, Maria J., and P. Garin. "The autonomic innervation of the rat diaphragm." General Pharmacology: The Vascular System 17.1 (1986): 109-112. Rat ICC 9 3949143
20077 VIP (Vasoactive Intestinal Peptide) Antibody De Girolamo, P., et al. "The autonomous innervation of the buffalo (Bubalus bubalis) testis. An immunohistochemical study." European Journal of Histochemistry 47.2 (2009): 159-164. Bubalus Bubalis (Buffalo) IHC 1 12777213
20077 VIP (Vasoactive Intestinal Peptide) Antibody Peters, A. "The axon terminals of vasoactive intestinal polypeptide (VIP)-containing bipolar cells in rat visual cortex." Journal of neurocytology 19.5 (1990): 672-685. Rat 30 2077110
20077 VIP (Vasoactive Intestinal Peptide) Antibody Honrado, G. I., et al. "The circadian system of c-fos deficient mice." Journal of Comparative Physiology A 178.4 (1996): 563-570. Mouse 73 8847666
20077 VIP (Vasoactive Intestinal Peptide) Antibody Habecker, Beth A., et al. "The dependence on gp130 cytokines of axotomy induced neuropeptide expression in adult sympathetic neurons." Developmental neurobiology 69.6 (2009): 392-400. Mouse IHC Cytokine 21 19280647
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawamura, Koji, and Shigeo Takebayashi. "The development of noradrenaline-, acetylcholinesterase-, neuropeptide Y-and vasoactive intestinal polypeptide-containing nerves in human cerebral arteries." Neuroscience letters 175.1 (1994): 1-4. Human 16 7970186
20077 VIP (Vasoactive Intestinal Peptide) Antibody Duong, Chi Vinh, Markus Geissen, and Hermann Rohrer. "The developmental expression of vasoactive intestinal peptide (VIP) in cholinergic sympathetic neurons depends on cytokines signaling through LIFR?-containing receptors." Development 129.6 (2002): 1387-1396. Chick IHC Cytokine 21 11880348
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kato, J., et al. "The distribution of vasoactive intestinal polypeptides and calcitonin gene-related peptide in the periodontal ligament of mouse molar teeth." Archives of oral biology 35.1 (1990): 63-66. Mouse 16 2202278
20077 VIP (Vasoactive Intestinal Peptide) Antibody Stanke, Matthias, et al. "The early expression of VAChT and VIP in mouse sympathetic ganglia is not induced by cytokines acting through LIFR? or CNTFR?." Mechanisms of development 91.1 (2000): 91-96. Mouse IHC Cytokine 17 10704834
20077 VIP (Vasoactive Intestinal Peptide) Antibody Anderson, David J., et al. "The effect of binge fetal alcohol exposure on the number of vasoactive intestinal peptide-producing neurons in fetal sheep brain." Developmental neuroscience 30.4 (2007): 276-284. Sheep 2 17960055
20077 VIP (Vasoactive Intestinal Peptide) Antibody Johnson, R. J. R., et al. "The effects of age on the overall population and on subpopulations of myenteric neurons in the rat small intestine." Journal of anatomy 192.4 (1998): 479-488. Rat IHC 87 9723975
20077 VIP (Vasoactive Intestinal Peptide) Antibody Orita, Sumihisa, et al. "The effects of risedronate and exercise on osteoporotic lumbar rat vertebrae and their sensory innervation." Spine 35.22 (2010): 1974-1982. Rat 9 20959778
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gelman, Diego M., et al. "The embryonic preoptic area is a novel source of cortical GABAergic interneurons." The Journal of Neuroscience 29.29 (2009): 9380-9389. Mouse IF 100 19625528
20077 VIP (Vasoactive Intestinal Peptide) Antibody Umemoto, Santa, et al. "The expression of neuropeptides and their mRNAs in the trigeminal mesencephalic nucleus following masseteric nerve transection." Molecular brain research 23.1 (1994): 93-99. 20 7518033
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rubin, Anna N., et al. "The germinal zones of the basal ganglia but not the septum generate GABAergic interneurons for the cortex." The Journal of Neuroscience 30.36 (2010): 12050-12062. Mouse IHC 22 20826668
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kozlov, Serguei V., et al. "The imprinted gene Magel2 regulates normal circadian output." Nature genetics 39.10 (2007): 1266-1272. Mouse 74 17893678
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kawakami, Fumio, et al. "The influence of serotonergic inputs on peptide neurons in the rat suprachiasmatic nucleus: an immunocytochemical study." Neuroscience letters 61.3 (1985): 273-277. Rat ICC 35 3909002
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jew, Jean Y., et al. "The intestine as a model for neuronal plasticity." Arch Histol Cytol 52.167 (1989): 80. IHC 23 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lee, SooHyun, et al. "The largest group of superficial neocortical GABAergic interneurons expresses ionotropic serotonin receptors." The Journal of Neuroscience 30.50 (2010): 16796-16808. Mouse IHC 99 21159951
20077 VIP (Vasoactive Intestinal Peptide) Antibody J Comp Neurol. 2011 Oct 1;519(14):2870-86. doi: 10.1002/cne.22662. The mouse olfactory peduncle. Brunjes PC1, Kay RB, Arrivillaga JP. Mouse IHC 21618219
20077 VIP (Vasoactive Intestinal Peptide) Antibody Drucker, D. J., et al. "The parathyroid hormone-like peptide gene is expressed in the normal and neoplastic human endocrine pancreas." Molecular Endocrinology 3.10 (1989): 1589-1595. Human parathyroid 104 2691879
20077 VIP (Vasoactive Intestinal Peptide) Antibody Scott, T. M., J. Robinson, and J. Foote. "The peptidergic innervation of the developing mesenteric vascular bed in the rat." Journal of anatomy 162 (1989): 177. Rat IHC 16 2478513
20077 VIP (Vasoactive Intestinal Peptide) Antibody Woolgar, JANE R., and T. M. Scott. "The relationship between innervation and arterial structure in late prenatal and early postnatal development of the rat jejunal artery." Journal of anatomy 167 (1989): 57. Rat 6 2630541
20077 VIP (Vasoactive Intestinal Peptide) Antibody Holzwarth, M. A., L. A. Cunningham, and N. Kleitman. "The Role of Adrenal Nerves in the Regulation of Adrenocortical Functionsa." Annals of the New York Academy of Sciences 512.1 (1987): 449-464. IHC 121 3126695
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kummer, W., et al. "The sensory and sympathetic innervation of guinea-pig lung and trachea as studied by retrograde neuronal tracing and double-labelling immunohistochemistry." Neuroscience 49.3 (1992): 715-737. Guinea Pig 216 1380140
20077 VIP (Vasoactive Intestinal Peptide) Antibody Geissen, Markus, et al. "The specification of sympathetic neurotransmitter phenotype depends on gp130 cytokine receptor signaling." Development 125.23 (1998): 4791-4801. Chick Cytokine 38 9806927
20077 VIP (Vasoactive Intestinal Peptide) Antibody Robertson, George N., Roger P. Croll, and Frank M. Smith. "The structure of the caudal wall of the zebrafish (Danio rerio) swim bladder: Evidence of localized lamellar body secretion and a proximate neural plexus." Journal of morphology (2014). Tadpole IF 0 24643973
20077 VIP (Vasoactive Intestinal Peptide) Antibody Card, J. P., and R. Y. Moore. "The suprachiasmatic nucleus of the golden hamster: immunohistochemical analysis of cell and fiber distribution." Neuroscience 13.2 (1984): 415-431. Hamster 305 6151147
20077 VIP (Vasoactive Intestinal Peptide) Antibody Butt, Simon JB, et al. "The temporal and spatial origins of cortical interneurons predict their physiological subtype." Neuron 48.4 (2005): 591-604. IHC 270 16301176
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kummer, Wolfgang. "Three types of neurochemically defined autonomic fibres innervate the carotid baroreceptor and chemoreceptor regions in the guinea-pig." Anatomy and embryology 181.5 (1990): 477-489. Guinea Pig 24 1973605
20077 VIP (Vasoactive Intestinal Peptide) Antibody Romero, Maria-Teresa, and Rae Silver. "Time course of peptidergic expression in fetal suprachiasmatic nucleus transplanted into adult hamster." Developmental brain research 57.1 (1990): 1-6. Hamster 20 2090363
20077 VIP (Vasoactive Intestinal Peptide) Antibody McCarson, Kenneth E., and Barry D. Goldstein. "Time course of the alteration in dorsal horn substance P levels following formalin: blockade by naloxone." Pain 41.1 (1990): 95-100. IHC 41 1693764
20077 VIP (Vasoactive Intestinal Peptide) Antibody De Giorgio, Roberto, et al. "Tissue distribution and innervation pattern of peptide immunoreactivities in the rat pancreas." Peptides 13.1 (1992): 91-98. Rat IHC 64 1377823
20077 VIP (Vasoactive Intestinal Peptide) Antibody Canbeyli, Resit S., Michael Lehman, and Rae Silver. "Tracing SCN graft efferents with Dil." Brain research 554.1 (1991): 15-21. 21 1718547
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kallo, Imre, et al. "Transgenic approach reveals expression of the VPAC2 receptor in phenotypically defined neurons in the mouse suprachiasmatic nucleus and in its efferent target sites." European Journal of Neuroscience 19.8 (2004): 2201-2211. Mouse IHC 37 15090046
20077 VIP (Vasoactive Intestinal Peptide) Antibody Floeter, M. K., and E. G. Jones. "Transplantation of fetal postmitotic neurons to rat cortex: survival, early pathway choices and long-term projections of outgrowing axons." Developmental Brain Research 22.1 (1985): 19-38. Rat 56 4041917
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cowen, Timothy, et al. "Transplanted sweat glands from mature and aged donors determine cholinergic phenotype and altered density of host sympathetic nerves." Journal of the autonomic nervous system 58.3 (1996): 153-162. 17 8912274
20077 VIP (Vasoactive Intestinal Peptide) Antibody Anat Embryol (Berl). 1988;178(3):207-17. Types and spatial distribution of vasoactive intestinal polypeptide (VIP)-containing synapses in the rat visual cortex. Hajós F1, Zilles K, Schleicher A, Kálmán M. Rat 38 3414975
20077 VIP (Vasoactive Intestinal Peptide) Antibody Giordano, Antonio, et al. "Tyrosine hydroxylase, neuropeptide Y, substance P, calcitonin gene-related peptide and vasoactive intestinal peptide in nerves of rat periovarian adipose tissue: an immunohistochemical and ultrastructural investigation." Journal of neurocytology 25.1 (1996): 125-136. Rat 68 8699194
20077 VIP (Vasoactive Intestinal Peptide) Antibody Holm, Ruth, et al. "Ultrastructural and electron immunohistochemical features of medullary thyroid carcinoma." Virchows Archiv A 414.5 (1989): 375-384. 20 2499093
20077 VIP (Vasoactive Intestinal Peptide) Antibody Anglade, Philippe, and Shigeru Tsuji. "Ultrastructural simultaneous localization of vasoactive intestinal polypeptide immunoreactivity and the acetylcholine-like cation in rat endocrine pancreas." Arch Histol Cytol 53 (1990): 553-558. Rat ICC 7 2078401
20077 VIP (Vasoactive Intestinal Peptide) Antibody Rieke, G. K., et al. "Ultrastructure of ependymal cells in primary cultures of cerebral cortex." Journal of neuroscience research 18.3 (1987): 484-492. 7 3437469
20077 VIP (Vasoactive Intestinal Peptide) Antibody Anat Histol Embryol. 2003 Jun;32(3): 154-60.Uterus-innervating neurones in porcine inferior mesenteric ganglion: an immunohistochemical characteristic. Wasowicz K1. Gilt (Pig) 2 12823101
20077 VIP (Vasoactive Intestinal Peptide) Antibody Folia Morphol (Warsz). 2002;61(1) :15-20.Uterus-innervating neurones of paracervical ganglion in the pig: immunohistochemical characteristics.Wasowicz K1, Podlasz P, Czaja K, Łakomy M. Pig 5 11905245
20077 VIP (Vasoactive Intestinal Peptide) Antibody Selzer, Faith, et al. "Vascular stiffness in women with systemic lupus erythematosus." Hypertension 37.4 (2001): 1075-1082. Human 201 11304506
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ju Kim, Myeung, et al. "Vasoactive intestinal peptide (VIP) and VIP mRNA decrease in the cerebral cortex of nNOS knock-out (?/?) mice." Brain research 978.1 (2003): 233-240. Mouse 6 12834919
20077 VIP (Vasoactive Intestinal Peptide) Antibody Histochemistry. 1989;90(5):347-51. Vasoactive intestinal peptide (VIP)-like immunoreactivity in the human sympathetic ganglia. Järvi R1, Helen P, Hervonen A, Pelto-Huikko M. Human 16 2565893
20077 VIP (Vasoactive Intestinal Peptide) Antibody Bowden, Jeffrey J., and Ian L. Gibbins. "Vasoactive intestinal peptide and neuropeptide Y coexist in non-noradrenergic sympathetic neurons to guinea pig trachea." Journal of the autonomic nervous system 38.1 (1992): 1-19. Guinea Pig 42 1588001
20077 VIP (Vasoactive Intestinal Peptide) Antibody Duffy, Linda C., et al. "Vasoactive intestinal peptide as a laboratory supplement to clinical activity index in inflammatory bowel disease." Digestive diseases and sciences 34.10 (1989): 1528-1535. 28 2791804
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hill, Esther L., and Robert Elde. "Vasoactive intestinal peptide distribution and colocalization with dopamine-?-hydroxylase in sympathetic chain ganglia of pig." Journal of the autonomic nervous system 27.3 (1989): 229-239. Pig 25 2794349
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sollars, Patricia J., and Gary E. Pickard. "Vasoactive intestinal peptide efferent projections of the suprachiasmatic nucleus in anterior hypothalamic transplants: correlation with functional restoration of circadian behavior." Experimental neurology 136.1 (1995): 1-11. ICC 26 7589329
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gerhold, Lynnette M., Tamas L. Horvath, and Marc E. Freeman. "Vasoactive intestinal peptide fibers innervate neuroendocrine dopaminergic neurons." Brain research 919.1 (2001): 48-56. 47 11689162
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hill, Joanna M., et al. "Vasoactive intestinal peptide in the brain of a mouse model for Down syndrome." Experimental neurology 183.1 (2003): 56-65. Mouse 25 12957488
20077 VIP (Vasoactive Intestinal Peptide) Antibody Jacomy, H., A. Burlet, and O. Bosler. "Vasoactive intestinal peptide neurons as synaptic targets for vasopressin neurons in the suprachiasmatic nucleus. Double-label immunocytochemical demonstration in the rat." Neuroscience 88.3 (1999): 859-870. IHC 24 10363823
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kudo, Takashi, et al. "Vasoactive intestinal peptide produces long-lasting changes in neural activity in the suprachiasmatic nucleus." Journal of neurophysiology 110.5 (2013): 1097-1106. 1 23741043
20077 VIP (Vasoactive Intestinal Peptide) Antibody Proc Natl Acad Sci U S A. 1985 Jan;82(1):245-7. Vasoactive intestinal peptide-containing neurons in the paraventricular nucleus may participate in regulating prolactin secretion. Mezey E, Kiss JZ. Rat 126 3881755
20077 VIP (Vasoactive Intestinal Peptide) Antibody Johnson, A. L., et al. "Vasoactive intestinal peptide-induced expression of cytochrome P450 cholesterol side-chain cleavage and 17 alpha-hydroxylase enzyme activity in hen granulosa cells." Biology of reproduction 51.2 (1994): 327-333. Hen 20 7948488
20077 VIP (Vasoactive Intestinal Peptide) Antibody Herness, M. S. "Vasoactive intestinal peptide-like immunoreactivity in rodent taste cells." Neuroscience 33.2 (1989): 411-419. 34 2622534
20077 VIP (Vasoactive Intestinal Peptide) Antibody DARTT, DARLENE A., et al. "Vasoactive intestinal peptide-stimulated glycoconjugate secretion from conjunctival goblet cells." Experimental eye research 63.1 (1996): 27-33. 48 8983961
20077 VIP (Vasoactive Intestinal Peptide) Antibody Hajos, F., K. Zilles, and K. Gallatz. "Vasoactive intestinal polypeptide (VIP) containing cells in the developing rat occipital hemisphere." Anatomy and embryology 182.1 (1990): 69-78. Rat 8 2240594
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sagar, Stephen M. "Vasoactive intestinal polypeptide (VIP) immunohistochemistry in the rabbit retina." Brain research 426.1 (1987): 157-163. Rabbit 21 3319043
20077 VIP (Vasoactive Intestinal Peptide) Antibody Chang, H. T., and Q. Tian. "Vasoactive intestinal polypeptide (VIP) immunoreactive elements in the caudal ventral striatum of the rat: a light and electron microscopic study." Brain research bulletin 26.6 (1991): 947-956. Rat 5 1933414
20077 VIP (Vasoactive Intestinal Peptide) Antibody Uusitalo, H., J. I. Lehtosalo, and A. Palkama. "Vasoactive intestinal polypeptide (VIP)-immunoreactive nerve fibers in the anterior uvea of the guinea pig." Ophthalmic research 17.4 (1985): 235-240. Guinea Pig IHC 12 4034158
20077 VIP (Vasoactive Intestinal Peptide) Antibody Eiden, L. E., et al. "Vasoactive intestinal polypeptide afferents to the bed nucleus of the stria terminalis in the rat: an immunohistochemical and biochemical study." Neuroscience 15.4 (1985): 999-1013. Rat IHC 43 3900807
20077 VIP (Vasoactive Intestinal Peptide) Antibody De Lanerolle, N. C., et al. "Vasoactive intestinal polypeptide and its receptor changes in human temporal lobe epilepsy." Brain research 686.2 (1995): 182-193. Human IHC 14 7583284
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sibony, Patrick A., et al. "Vasoactive intestinal polypeptide and the innervation of the human lacrimal gland." Archives of ophthalmology 106.8 (1988): 1085-1088. Human 42 3041945
20077 VIP (Vasoactive Intestinal Peptide) Antibody Stone, R. A. "Vasoactive intestinal polypeptide and the ocular innervation." Investigative ophthalmology & visual science 27.6 (1986): 951-957. Rat IHC 46 3710734
20077 VIP (Vasoactive Intestinal Peptide) Antibody PRATT, BARBARA L., and JOSEPH S. TAKAHASHI. "Vasoactive Intestinal Polypeptide and ?2-Adrenoceptor Agonists Regulate Adenosine 3?, 5?-Monophosphate Accumulation and Melatonin Release in Chick Pineal Cell Cultures*." Endocrinology 125.5 (1989): 2375-2384. Chick 34 2477231
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lamotte, Carole C. "Vasoactive intestinal polypeptide cerebrospinal fluid?contacting neurons of the monkey and cat spinal central canal." Journal of Comparative Neurology 258.4 (1987): 527-541. Cat, Monkey 17 2438312
20077 VIP (Vasoactive Intestinal Peptide) Antibody Mezey, E. "Vasoactive intestinal polypeptide immunopositive neurons in the paraventricular nucleus of homozygous Brattleboro rats." Neuroendocrinology 42.1 (1986): 88-90. Rat 17 3510403
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kobayashi, S., et al. "Vasoactive intestinal polypeptide immunoreactive and cholinergic nerves in the whole mount preparation of the major cerebral arteries of the rat." Histochemistry 79.3 (1983): 377-381. Rat IHC 50 6360964
20077 VIP (Vasoactive Intestinal Peptide) Antibody de Girolamo, Paolo, et al. "Vasoactive intestinal polypeptide immunoreactive nerves in the gill arch of teleost fish,Carassius auratus L." Acta histochemica 99.1 (1997): 13-22. Fish 3 9150792
20077 VIP (Vasoactive Intestinal Peptide) Antibody Peters, Alan, Douglas L. Meinecke, and Azarias N. Karamanlidis. "Vasoactive intestinal polypeptide immunoreactive neurons in the primary visual cortex of the cat." Journal of neurocytology 16.1 (1987): 23-38. Cat 37 3295123
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lundeberg, Lena, and Klas Nordlind. "Vasoactive intestinal polypeptide in allergic contact dermatitis: an immunohistochemical and radioimmunoassay study." Archives of dermatological research 291.4 (1999): 201-206. IHC 20 10335916
20077 VIP (Vasoactive Intestinal Peptide) Antibody Martinet, Lise, et al. "Vasoactive intestinal polypeptide in the suprachiasmatic nucleus of the mink (Mustela vison) could play a key role in photic induction." Journal of neuroendocrinology 7.1 (1995): 69-79. Mink 14 7735300
20077 VIP (Vasoactive Intestinal Peptide) Antibody Connor, James R., and Jerald J. Bernstein. "Vasoactive intestinal polypeptide neurons in fetal cortical homografts to adult rat spinal cord." Brain research 367.1 (1986): 214-221. Rat IHC 13 3516303
20077 VIP (Vasoactive Intestinal Peptide) Antibody Fitzgerald, Malinda EC, Ruth B. Caldwell1, and Anton Reiner. "Vasoactive intestinal polypeptide-containing nerve fibers are increased in abundance in the choroid of dystrophic RCS rats." Current eye research 11.6 (1992): 501-515. Rat 9 1380413
20077 VIP (Vasoactive Intestinal Peptide) Antibody FUNAHASHI, Atsushi. "Vasoactive Intestinal Polypeptide?containing Neurons and Processes in the Developing Hippocampus of Rats Prenatally Exposed to Methylazoxymethanol Acetate." Congenital Anomalies 35.1 (1995): 113-122. 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Connor, J. R., and A. Peters. "Vasoactive intestinal polypeptide-immunoreactive neurons in rat visual cortex." Neuroscience 12.4 (1984): 1027-1044. Rat 89 6384816
20077 VIP (Vasoactive Intestinal Peptide) Antibody Galabov, P. "Vasoactive Intestinal Polypeptide-Like Immunoreactivity (VIP-LIR) as a Marker of the Ependymal Cells in Rat CNS." Comptes Rendus de l'Academie Bulgare des Sciences 54.3 (2001): 79. Rat IHC 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Cloues, Robin, Cindy Ramos, and Rae Silver. "Vasoactive intestinal polypeptide-like immunoreactivity during reproduction in doves: Influence of experience and number of offspring." Hormones and behavior 24.2 (1990): 215-231. Dove 34 2194925
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vittoria, A., et al. "Vasoactive intestinal polypeptidergic innervation and gastroenteropancreatic system: an immunocytochemical study in the hedgehog Erinaceus europaeus." Cells Tissues Organs 143.1 (1992): 84-88. Hedgehog 2 1585793
20077 VIP (Vasoactive Intestinal Peptide) Antibody Bosler, Olivier, and Alain Beaudet. "VIP neurons as prime synaptic targets for serotonin afferents in rat suprachiasmatic nucleus: a combined radioautographic and immunocytochemical study." Journal of neurocytology 14.5 (1985): 749-763. Rat 131 2419520
20077 VIP (Vasoactive Intestinal Peptide) Antibody de Girolamo, Paolo, et al. "VIP-like Immunoreactive Cells in the Kidney of Goldfish (< i> Carassius auratus)." General and comparative endocrinology 102.1 (1996): 34-38. Goldfish IHC 1 8860306
20077 VIP (Vasoactive Intestinal Peptide) Antibody Schuster, D. J., et al. "Visualization of spinal afferent innervation in the mouse colon by AAV8?mediated GFP expression." Neurogastroenterology & Motility 25.2 (2013): e89-e100. Mouse IHC 2 23252426
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kim, Tahnbee, Florentina Soto, and Daniel Kerschensteiner. "An excitatory amacrine cell detects object motion and provides feature-selective input to ganglion cells in the mouse retina." eLife (2015): e08025. Mouse 0 25988808
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ünal, Bengi, et al. "Anatomical and electrophysiological changes in striatal TH interneurons after loss of the nigrostriatal dopaminergic pathway." Brain Structure and Function 220.1 (2015): 331-349. Mouse IF Parkinson's 7 24173616
20077 VIP (Vasoactive Intestinal Peptide) Antibody Gaykema, Ronald PA, et al. "Characterization of excitatory and inhibitory neuron activation in the mouse medial prefrontal cortex following palatable food ingestion and food driven exploratory behavior." Frontiers in neuroanatomy 8 (2014). Mouse 1 25071465
20077 VIP (Vasoactive Intestinal Peptide) Antibody Prönneke, Alvar, et al. "Characterizing VIP Neurons in the Barrel Cortex of VIPcre/tdTomato Mice Reveals Layer-Specific Differences." Cerebral Cortex (2015): bhv202. Mouse IF 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Li, Quan, et al. "Circadian rhythm disruption in a mouse model of Rett syndrome circadian disruption in RTT." Neurobiology of disease 77 (2015): 155-164. Mouse 2 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Neske, Garrett T., Saundra L. Patrick, and Barry W. Connors. "Contributions of Diverse Excitatory and Inhibitory Neurons to Recurrent Network Activity in Cerebral Cortex." The Journal of Neuroscience 35.3 (2015): 1089-1105. Mouse 3 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Tyan, Leonid, et al. "Dendritic inhibition provided by interneuron-specific cells controls the firing rate and timing of the hippocampal feedback inhibitory circuitry." The Journal of Neuroscience 34.13 (2014): 4534-4547. Mouse 11 24671999
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ma, Jian, et al. "Development of layer 1 neurons in the mouse neocortex." Cerebral Cortex 24.10 (2014): 2604-2618. Mouse 8 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Ahn, Sandra, et al. "Differentiation of human pluripotent stem cells into medial ganglionic eminence vs. caudal ganglionic eminence cells." Methods (2015). Human 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Del Fiacco, M., et al. "Effect of the neuropeptides vasoactive intestinal peptide, peptide histidine methionine and substance P on human major salivary gland secretion." Oral diseases 21.2 (2015): 216-223. Human 0 24725136
20077 VIP (Vasoactive Intestinal Peptide) Antibody Del Fiacco, M., et al. "Effect of the neuropeptides vasoactive intestinal peptide, peptide histidine methionine and substance P on human major salivary gland secretion." Oral diseases 21.2 (2015): 216-223. Human 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Kim, Tae‐Gon, et al. "Efficient specification of interneurons from human pluripotent stem cells by dorsoventral and rostrocaudal modulation." Stem Cells 32.7 (2014): 1789-1804. Human 12 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody McDonald, A. J., and V. Zaric. "Extrinsic origins of the somatostatin and neuropeptide Y innervation of the rat basolateral amygdala." Neuroscience 294 (2015): 82-100. Rat IF 3 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Park, Silvia JH, et al. "Function and Circuitry of VIP+ Interneurons in the Mouse Retina." The Journal of Neuroscience 35.30 (2015): 10685-10700. Mouse IF 1 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Scheuss, Volker, and Tobias Bonhoeffer. "Function of dendritic spines on hippocampal inhibitory neurons." Cerebral Cortex 24.12 (2014): 3142-3153. 9 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Keshavarzi, Sepideh, et al. "Functional properties and projections of neurons in the medial amygdala." The Journal of Neuroscience 34.26 (2014): 8699-8715. Mouse 8 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody McDonald, A. J., and V. Zaric. "GABAergic somatostatin-immunoreactive neurons in the amygdala project to the entorhinal cortex." Neuroscience 290 (2015): 227-242. Rat IF 3 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Lin, Shing‐Hong, et al. "Genetic mapping of ASIC4 and contrasting phenotype to ASIC1a in modulating innate fear and anxiety." European Journal of Neuroscience (2015). Mouse 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Zhu, Yongling, et al. "Genetically targeted binary labeling of retinal neurons." The Journal of Neuroscience 34.23 (2014): 7845-7861. Mouse 9 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Miyamoto, Yuta, and Takaichi Fukuda. "Immunohistochemical study on the neuronal diversity and three-dimensional organization of the mouse entopeduncular nucleus." Neuroscience research 94 (2015): 37-49. Mouse 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Stoyek, Matthew R., Roger P. Croll, and Frank M. Smith. "Intrinsic and extrinsic innervation of the heart in zebrafish (Danio rerio)." Journal of Comparative Neurology (2015). Fish 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Akrouh, Alejandro, and Daniel Kerschensteiner. "Morphology and function of three VIP-expressing amacrine cell types in the mouse retina." Journal of neurophysiology (2015): jn-00526. Mouse 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Iijima, Takatoshi, et al. "Neuronal cell type–specific alternative splicing is regulated by the KH domain protein SLM1." The Journal of cell biology 204.3 (2014): 331-342. Mouse 7 24469635
20077 VIP (Vasoactive Intestinal Peptide) Antibody Muñoz-Manchado, A. B., et al. "Novel striatal GABAergic interneuron populations labeled in the 5HT3aEGFP mouse." Cerebral Cortex (2014): bhu179. Mouse IF 7 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Sohn, Jaerin, et al. "Preprodynorphin‐expressing neurons constitute a large subgroup of somatostatin‐expressing GABAergic interneurons in the mouse neocortex." Journal of Comparative Neurology 522.7 (2014): 1506-1526. Mouse IF 3 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Vujovic, Nina, et al. "Projections from the subparaventricular zone define four channels of output from the circadian timing system." Journal of Comparative Neurology (2015). 2 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Zhang, Nanyan, et al. "S-SCAM, A Rare Copy Number Variation Gene, Induces Schizophrenia-Related Endophenotypes in Transgenic Mouse Model." The Journal of Neuroscience 35.5 (2015): 1892-1904. Mouse 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Chao, Chi‐Chao, et al. "Sudomotor Innervation in Transthyretin Amyloid Neuropathy: Pathology and Functional Correlates." Annals of neurology (2015). 0 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody Wang, Joshua L., et al. "Suprachiasmatic neuron numbers and rest‐activity circadian rhythms in older humans." Annals of neurology (2015). Human Alzheimer 4 not defined
20077 VIP (Vasoactive Intestinal Peptide) Antibody CINTI, GIAN FRANCO MARCHESIl ANdSAVERIO. "Tyrosine hydroxylase, neuropeptide Y, substance P, calcitonin gene-related peptide and vasoactive intestinal peptide in nerves of rat periovarian adipose tissue: an immunohistochemical and ultrastructural investigation." Rat 0 not found
20077 VIP (Vasoactive Intestinal Peptide) Antibody Melone, Mariarosa AB, et al. "Unusual Stüve‐Wiedemann syndrome with complete maternal chromosome 5 isodisomy." Annals of clinical and translational neurology 1.11 (2014): 926-932. Cancer 1 25540807
20077 VIP (Vasoactive Intestinal Peptide) Antibody Wu, Xiujuan, et al. "Vasoactive Intestinal Polypeptide Promotes Intestinal Barrier Homeostasis and Protection Against Colitis in Mice." (2015): e0125225. Mouse 0 25932952

Q & A Wall

Login or Register to ask any question about this product.

If I take out 10 µL of VIP Antibody from the vial after it is reconstituted, how much do I need to add to dilute it out to 1/10?
Question By Jeff

As a best practice, we recommend customers reconstitute the newly opened vial with 100 µL of distilled or deionized water, and then add 900 µL of PBS or Tris buffer. The antibody will then be diluted to a 1/10 ratio. Then make aliquots based on intended use and freeze. One suggestion is to aliquot 10 vials with 100 µL each into small eppendorf or cryovials and store the vials you don’t plan to use soon (within 1 -2 weeks) in the freezer.
Therefore in your case, Jeff, if you remove 10 µL of antibody from the vial, you are left with 90 µL of antibody. To get the same 1/10 ration you need to add 810 µL of buffer to the 90 µL of antibody for a total of 900 µL. This would provide the same 1/10 dilution, or 90 µL antibody to the total of 900 µL both antibody and buffer.

Answer By Colleen on 2015-10-29 14:13:58

I am interested in your product 20077. My VIP protein has sequence: KAMLPRNGSQLLLLIALCSVLYTRTLSLPYPSM RRPTRHADGLFTSGYSKLLGQLSARRYLESLIGKRVSNELM EEQMPVKRHSDAIFTDNYSRFRKQMAVKKYLNSVLTGKRSQEDPSTLKEDSPRNDPPFPESYDDVSVDELLSHLPLV Please, can you check the epitope of your anti-VIP antibodies against my sequence for possible crossreactivity,
Question By Svetlana

VIP has been used effectively in buffalo, chicken, guinea pig, hamster, human, monkey, mouse, pig, rat, sparrow, sting ray, and zebrafish. Statistically it should work with your protein but as you know that is not always possible to predict. It is advisable to try a dilution series to determine the optimal antibody dilution to use. For example, if a product data sheet suggests using a 1:500 dilution, you might make dilutions of 1:50, 1:100, 1:500, 1:1,000 and 1:10,000, to determine the optimal dilution.

Answer By Technical Support on 2013-08-09 15:16:35


This product contains the preservative sodium azide. The concentration percent of the sodium azide is ≤ .09%. Although this hazardous substance is a concentration below that required for the preparation of a Material Safety Data Sheet, we created a standard MSDS for your records.

Download MSDS